(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE56

ACAM1_4.PE56         Location/Qualifiers
FT   CDS_pept        59946..60371
FT                   /locus_tag="AM1_C0056"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340511"
FT                   /db_xref="GeneID:5686278"
FT                   /translation="MEQTNVETVQKFFEAHYAGDFDRAFQAYAQPNFQWIVSSSSNESL
FT                   RAAIPWAGYTHQGKEGYIRLVTLLFSEFEVLTFEPSRYTDAGDRVFVEGHFTFRHRQTG
FT                   KIADSDWLARFDMEDGRITGGQFYENTVGVAEARRAA"
FT                   /protein_id="YP_001521505.1"
     ATGGAACAGA CTAATGTTGA GACTGTACAA AAGTTTTTTG AAGCCCACTA CGCAGGCGAT        60
     TTTGACCGCG CTTTTCAAGC CTATGCCCAG CCTAACTTCC AATGGATTGT CTCCAGCAGT       120
     AGTAACGAGA GCTTAAGAGC AGCCATTCCC TGGGCAGGTT ACACCCACCA GGGTAAAGAA       180
     GGCTACATCC GTCTCGTGAC GTTACTATTC TCGGAATTTG AAGTACTGAC ATTTGAACCG       240
     AGTCGCTACA CCGATGCAGG CGATCGCGTT TTCGTCGAGG GCCATTTCAC CTTCCGCCAT       300
     CGTCAGACAG GCAAGATAGC CGACAGCGAC TGGCTCGCTC GCTTCGATAT GGAAGACGGT       360
     CGGATCACAG GCGGTCAATT TTACGAAAAC ACAGTAGGCG TAGCTGAGGC GCGCCGAGCA       420
     GCGTAG                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page