(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE59

ACAM1_4.PE59         Location/Qualifiers
FT   CDS_pept        62567..63160
FT                   /locus_tag="AM1_C0059"
FT                   /gene_family="HOG000218410" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340514"
FT                   /db_xref="GeneID:5686281"
FT                   /translation="MSLNSYSCETELMDFKIYTLETAPDESKGALQQAEQTFKFIPNLE
FT                   GILAESPATLKSGMALWDLFETTSFTPIEQQVIYLTANYEHECSYCVAAHSGLAKMVGM
FT                   SAEDIEAIRNGKPLIDQKLQALRHFTKRMISERGWVGDEEIEEFLAAGYTRQQILEVIL
FT                   GIAVKVIHNYTNHIAKTPLDKAFQPYTWSKPSVP"
FT                   /protein_id="YP_001521508.1"
     TTGTCTCTCA ATAGCTATAG TTGTGAAACT GAACTTATGG ACTTCAAAAT TTACACCCTT        60
     GAGACAGCTC CAGATGAGTC TAAGGGAGCA CTCCAACAGG CTGAACAAAC GTTCAAATTT       120
     ATCCCAAATC TGGAAGGAAT CCTTGCAGAA TCTCCAGCTA CCTTAAAAAG TGGTATGGCC       180
     CTTTGGGATC TATTCGAGAC AACCAGTTTT ACTCCCATTG AGCAACAAGT TATTTATCTC       240
     ACTGCTAACT ATGAGCACGA ATGTAGTTAT TGCGTGGCTG CACACTCTGG TTTAGCCAAG       300
     ATGGTTGGAA TGTCTGCAGA AGATATTGAG GCAATTCGCA ATGGCAAACC CCTAATAGAC       360
     CAAAAGTTGC AGGCACTACG ACATTTCACC AAAAGAATGA TTTCAGAAAG AGGTTGGGTA       420
     GGTGATGAGG AGATTGAAGA ATTTTTGGCA GCAGGGTATA CCCGGCAACA AATTTTAGAA       480
     GTGATTTTAG GTATTGCCGT AAAAGTCATT CACAATTACA CAAATCATAT TGCTAAAACT       540
     CCTTTAGATA AGGCTTTTCA GCCCTATACA TGGTCAAAGC CTTCTGTCCC TTAG             594
//

If you have problems or comments...

PBIL Back to PBIL home page