(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE6

ACAM1_4.PE6          Location/Qualifiers
FT   CDS_pept        complement(2686..3132)
FT                   /locus_tag="AM1_C0006"
FT                   /gene_family="HOG000022977" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340461"
FT                   /db_xref="GeneID:5686228"
FT                   /translation="MTQVLTAQVLFPAKEWDTQYGPRLNAKIKVANGEEAKLWGPPGDA
FT                   ALLALRRGQTIQIAKDGKGKYSLVEQAPVPGQSPVDEGAPLDDGELNGEVKNAIASYIT
FT                   HRAALYSFCYQEASRELEKHEASEETVKCAASTLFIAAQKKFGI"
FT                   /protein_id="YP_001521455.1"
     atgacccaag tattaaccgc ccaagtcctt ttcccggcca aagaatggga tacccagtat        60
     ggcccacgcc ttaacgccaa aatcaaggta gcgaatggtg aagaggctaa gttatgggga       120
     ccacctggcg atgcagcttt gctcgctctc cgtagaggcc aaaccatcca gattgccaaa       180
     gatggcaaag gcaagtacag cctggtcgag caagccccgg ttccaggtca atccccagtg       240
     gatgagggtg cgcccctgga tgatggggag ctgaatggag aggtcaagaa tgcgattgcc       300
     agttacatca ctcatcgagc agccctgtat tccttctgtt atcaagaagc atctagagag       360
     ctagagaagc acgaagcaag tgaagagacc gtcaagtgtg cggccagcac tttgttcatt       420
     gctgctcaga agaagtttgg gatttga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page