(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE60

ACAM1_4.PE60         Location/Qualifiers
FT   CDS_pept        complement(63505..64326)
FT                   /locus_tag="AM1_C0060"
FT                   /gene_family="HOG000075379" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family
FT                   protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340515"
FT                   /db_xref="GeneID:5686282"
FT                   /translation="MKESMEMLAKDPNSELFSTDIEPLRIDVIGSLITAAPIDVLVNVI
FT                   LVWAKQHKSKMVCIANTHMLVDAHQKPSFGEVLKDSDIVTPNAMPLVWLLKRMGVKTQE
FT                   IVTSLNLMQCLCQKASQQKVSIFFLGSQSLILQKMRHRLAQDFPELLIAGMEPLPIRPL
FT                   TLDQRQKLIQRIKHSGAGLVMVAYSSPKQEYWMAEHKNQIEAVMIGVGGAFPAYAGLNS
FT                   SVPTWMKEIGFEWIYRFFQEPTKFWKKHVKTTSIFIHLALNQIWNRYFELR"
FT                   /protein_id="YP_001521509.1"
     ttgaaggagt ctatggaaat gctagccaaa gatcctaatt cagagctatt ctcaactgat        60
     attgaaccac ttcgaataga tgtcattggc tctctcatca ctgcagcccc tattgatgtg       120
     ctggttaatg taatcctagt ttgggcaaag caacacaaaa gtaaaatggt ctgcattgca       180
     aatactcata tgctagttga tgctcatcaa aaacctagct ttggtgaagt gctgaaagat       240
     tctgacatag tcacaccaaa tgctatgcca ttggtgtggc tgctgaagag aatgggagtg       300
     aaaacacaag aaatagtaac gagcttaaat ttaatgcaat gcctttgtca gaaagcttct       360
     cagcagaagg tcagcatttt ctttctaggt tcacagtccc tgatactgca aaagatgaga       420
     catcgacttg cacaagattt tccagagctg ctgattgcag gaatggaacc tttacctatt       480
     cgacccttaa cactagatca aaggcaaaag ctgatacagc ggattaaaca cagtggtgca       540
     gggctggtga tggttgccta tagctctcct aaacaagaat attggatggc tgaacataag       600
     aatcagattg aggcagtcat gatcggtgtt ggtggagcct ttccagctta tgcaggtttg       660
     aattccagcg tacccacttg gatgaaggaa ataggttttg agtggatcta taggttcttt       720
     caagaaccga caaagttttg gaaaaaacat gttaagacca cttcaatatt tatccatctt       780
     gccttgaatc agatttggaa ccgttacttt gaactaaggt ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page