(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE62

ACAM1_4.PE62         Location/Qualifiers
FT   CDS_pept        65512..65946
FT                   /locus_tag="AM1_C0062"
FT                   /gene_family="HOG000022996" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340517"
FT                   /db_xref="GeneID:5686284"
FT                   /translation="MPTPQPISSLTIHLTPEHLGFLAYLYPKEDPEDALIKLLDSARTR
FT                   AIRRAEQQVRVLHLDQEQAEDQEEDPEESVSLSADVVENPIGALQELCQRQQISMPRYE
FT                   FEVIPEGFRCLVLAMGLRGVGEGRSKKQAKVMAGHCSFKK"
FT                   /protein_id="YP_001521511.1"
     ATGCCGACCC CCCAGCCAAT CTCCAGTCTA ACCATCCACC TCACCCCTGA ACACCTTGGC        60
     TTCCTCGCCT ATCTCTACCC CAAAGAAGAT CCAGAAGACG CACTGATCAA GCTCCTCGAT       120
     AGTGCCCGAA CCCGAGCCAT TCGCAGAGCA GAACAGCAAG TGAGAGTCCT ACACCTAGAC       180
     CAGGAGCAAG CCGAGGACCA GGAGGAAGAC CCAGAGGAAT CCGTGAGCTT GTCTGCCGAT       240
     GTGGTGGAGA ATCCGATTGG AGCATTACAG GAGTTATGCC AGCGTCAGCA AATCTCTATG       300
     CCCAGGTATG AGTTCGAGGT AATACCGGAA GGATTTCGCT GTTTGGTGCT GGCGATGGGA       360
     TTGCGGGGAG TTGGTGAGGG GCGGTCGAAG AAGCAGGCGA AGGTGATGGC TGGGCACTGT       420
     TCATTTAAGA AGTGA                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page