(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE64

ACAM1_4.PE64         Location/Qualifiers
FT   CDS_pept        66314..66979
FT                   /locus_tag="AM1_C0064"
FT                   /gene_family="HOG000023193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340519"
FT                   /db_xref="GeneID:5686286"
FT                   /translation="MKCTPAWVKIFPPWLSEGWTIHFIDRESRYWFEARAGLKDESLFE
FT                   KSVKAAWDWAKPSSSIRWFTDGERRYSKVLWKLASAYLPRSTTTQAYPFRKIWRAGLEV
FT                   AMKLKGSQGKPRVVWVNREHPYTAISPKSDVHANHLEALHSSLRRRASSYRRRQNHYAK
FT                   TVEGLQRALNVQRLIHNWCRSHYSHGYQRTPAMVMGFIQRPVKIGEVLTVRAFECLTS"
FT                   /protein_id="YP_001521513.1"
     ATGAAGTGTA CACCCGCGTG GGTAAAAATC TTCCCCCCCT GGCTCAGTGA AGGTTGGACT        60
     ATTCATTTCA TCGACCGTGA GAGTCGCTAT TGGTTCGAGG CTCGCGCGGG TCTTAAGGAT       120
     GAATCATTAT TTGAGAAAAG TGTCAAAGCT GCTTGGGATT GGGCTAAACC CAGTTCATCG       180
     ATTCGTTGGT TCACAGATGG AGAACGTCGA TACTCCAAGG TATTGTGGAA GCTAGCGAGT       240
     GCCTACTTGC CCAGGAGTAC CACGACCCAG GCCTATCCTT TTCGCAAAAT ATGGCGAGCG       300
     GGTTTAGAGG TGGCGATGAA GCTCAAAGGG TCTCAAGGAA AACCTCGGGT AGTGTGGGTT       360
     AATCGAGAGC ATCCTTATAC GGCCATTAGC CCCAAGAGCG ATGTCCATGC CAATCATCTT       420
     GAAGCCCTCC ACAGTTCTTT GAGACGACGG GCTAGCAGTT ATCGTAGACG CCAGAATCAC       480
     TATGCCAAAA CTGTTGAGGG ATTACAAAGA GCCCTGAACG TGCAGCGATT GATTCACAAT       540
     TGGTGTCGTT CTCACTACAG CCATGGATAC CAGCGAACCC CAGCAATGGT GATGGGATTT       600
     ATACAAAGGC CCGTTAAGAT TGGCGAAGTG TTAACAGTCA GAGCTTTTGA ATGCCTCACT       660
     TCTTAA                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page