(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE65

ACAM1_4.PE65         Location/Qualifiers
FT   CDS_pept        67480..68097
FT                   /locus_tag="AM1_C0065"
FT                   /gene_family="HOG000022997" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340520"
FT                   /db_xref="GeneID:5686287"
FT                   /translation="MTPPIVALNPKPIPQTIPQLPKSVPSSLKLVSRTAFPKETPEGTR
FT                   PPKREQGYGELGGIRRSSRRASQTTRLKKVPHSTSSETLQVNQPRTSRESAELERRFRN
FT                   LELRQKNLVEQVSKRGELEYLAVAKNGAGRYWITVAGTGKPFMRESFATPGFCWECAVE
FT                   IEANFEILQVIELRPPETIERIEEMVQAVLERERVAESWGWG"
FT                   /protein_id="YP_001521514.1"
     ATGACTCCCC CAATCGTCGC CCTCAACCCC AAGCCTATCC CTCAGACCAT CCCACAACTA        60
     CCTAAGTCCG TCCCTTCCTC CCTCAAACTG GTTAGTAGGA CAGCATTTCC TAAGGAAACA       120
     CCGGAAGGCA CCCGGCCACC CAAGCGAGAA CAAGGGTATG GAGAGCTGGG AGGAATACGC       180
     CGGAGTTCTA GACGAGCTTC CCAGACAACC AGACTAAAGA AAGTACCTCA TTCGACATCC       240
     TCTGAAACCC TCCAGGTCAA TCAACCGCGA ACTTCTAGAG AATCAGCAGA GCTGGAGAGG       300
     CGATTCAGGA ATCTGGAGCT GCGCCAGAAG AATCTAGTTG AGCAAGTCAG TAAGAGAGGG       360
     GAGCTGGAGT ATCTGGCTGT TGCCAAGAAT GGGGCTGGAC GATACTGGAT TACCGTGGCA       420
     GGGACGGGGA AGCCTTTTAT GAGGGAATCG TTTGCTACAC CTGGGTTCTG TTGGGAGTGT       480
     GCCGTTGAGA TTGAGGCGAA CTTTGAGATC CTTCAGGTGA TAGAGCTACG GCCACCGGAG       540
     ACTATCGAGC GGATTGAAGA GATGGTCCAG GCGGTGTTGG AGCGGGAGCG GGTTGCGGAG       600
     AGCTGGGGTT GGGGGTGA                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page