(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE66

ACAM1_4.PE66         Location/Qualifiers
FT   CDS_pept        complement(68417..69148)
FT                   /locus_tag="AM1_C0066"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="GI:158340521"
FT                   /db_xref="GeneID:5686288"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSPPQKSQSK"
FT                   /protein_id="YP_001521515.1"
     atgttgaccc attgggaatc tatcgaatcc caagccatgc aggaaaactg gtcttatgcg        60
     gaattcttac tagccttgtg cgaaacggag gcccaacgaa gagaacaagc tcgtctaaaa       120
     cgtgccctca ccgaagccag gctcccaaac gcaaaaagtt ttaccaactt tgactttagc       180
     cattgtcccc agctcaatcc agctcccttg atgcaattag ccgcagatcc gggttggttg       240
     gagcgcgccg agaattgcct tattctgggg ccctcgggtg ttggaaaaac acatctggcc       300
     actggggtgt ccaaaaagat gctggaattc ggtaagcggg tgaagttctt tgcagccaac       360
     gcattggtcc agcaactgca acaggcgaag ctccaactgc agctgcatcc aatgctcaaa       420
     aaactggacc gctatgatct gttgatcttg gatgacttgg gctattgcaa aaagtcggaa       480
     gcggaaacgt ccgttctgtt tgaattaatt gcgcatcgct atgaacgaaa aagtttgttg       540
     attacagcga atcaaccctt cagccaatgg gatgacattt tcactgattc gatgatggcg       600
     gtggctgcca ttgatcgctt aattcatcat ggcttgatta tcgaaattca agccgatagt       660
     tatcggcgca aatcagcgac tcagagaacg gctcaaactc agtctccacc tcaaaaatcc       720
     cagtccaaat aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page