(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE67

ACAM1_4.PE67         Location/Qualifiers
FT   CDS_pept        complement(68976..70712)
FT                   /locus_tag="AM1_C0067"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="GI:158340522"
FT                   /db_xref="GeneID:5686289"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQADAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIQGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT                   /protein_id="YP_001521516.1"
     gtgcctaaca aaagaattga ttcctatcat actcgtgttt atatgaacgg aagagacctc        60
     ggcttaaaac aagctgatgc agcttacatt gccgaaatat ctacaagaac cggacaacga       120
     attgaggccg gcacccatca acctaatcgc ggccgccttc aggaccaacg caccgttccc       180
     gaccccttag ctgatgtgtg ggaagacgag ctagaaccaa tgctgcgtcg agacccacgc       240
     ctcaaaccca tgaccctgta tgagtacctg caggataagt atccaggcca gtatccccaa       300
     gtcctgcgga ccctacaacg tcgggtgaga acgtggaaag ccttacatgg accaagccct       360
     gaagtgatgt ttgaattgcg tcatgaacca ggggtacaag ggttctccga ttttacagaa       420
     ctcaaaggca tcacgattac cattgccggc aaaccctttg agcacctgat ataccattac       480
     cgtctgggat atagcggctg gcgatatgcc cagatcatcc aaggaggcga aagctttgtt       540
     gccctctcag aaggattgca aaatgccttt gcagcctgtg gaggtgttcc tacacagcat       600
     cgtactgata gtttgagtgc agcctatcgc aacatgggcg gccgccggtc caaaaacctc       660
     acgcgtttgt acgacgaact gtgtgaccac tatcggctag aacccactcg taacaacaaa       720
     ggtgtagccc atgagaatgg ctccattgaa tctccccatg gccatctcaa aaaccgaatt       780
     aagcaggcga tctatctgcg cggcagtgca gattttacga gcgttgctga gtatcaagcc       840
     ttaattgatg cacaggttgc caagttgaat cagcagtgcc aaaccaagta tgagcaagag       900
     aaagaccatc tacaaccact gcccaaatat cgaacccctg actatgaagt gctcacggct       960
     aaagtcagca aacgcagcac catcgatgtt cgctgcattc tatacaccgt cccttctcga      1020
     ctgattggtc gtcaattgga actgcatcta taccatgacc ggattgtcgg ctatctggag      1080
     cgacacccgg tggtggaatt gccgaggaag cgcgtcagtg gcaaaggcaa acgtcgcgac      1140
     cgttgcatca actatcgcca tgttattggt tcaatgcgat tgaagcctcg tgcttttatc      1200
     tattgcacct ggcaatcaga cctacttccc aatcctgaat accgccaaat ctgggaacag      1260
     ctcaaagccc aatttgacct ggagcaggct gccaagatca tcgtggaagc cctgtatatt      1320
     gctgcggttc aagataaaga acaggccgta gcagtgtact tacagcagca gcttcgctca      1380
     tccagcctta ccctcaatcg cctgaaaaaa cagtttgagc cgcctcagat gaagcaggtt      1440
     cctgaactca gcattgaaca acattcactt gaactttatg acaaactcct cccctcctgc      1500
     tcagtccccg ctgagcccct accagcacct gagcctctat ttaaaaaagc tcaggctctc      1560
     ccacatgttg acccattggg aatctatcga atcccaagcc atgcaggaaa actggtctta      1620
     tgcggaattc ttactagcct tgtgcgaaac ggaggcccaa cgaagagaac aagctcgtct      1680
     aaaacgtgcc ctcaccgaag ccaggctccc aaacgcaaaa agttttacca actttga         1737
//

If you have problems or comments...

PBIL Back to PBIL home page