(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE68

ACAM1_4.PE68         Location/Qualifiers
FT   CDS_pept        71092..71457
FT                   /locus_tag="AM1_C0068"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340523"
FT                   /db_xref="GeneID:5686290"
FT                   /translation="MPPIPIRWVLIRDPQGRCKPQALLCTDLEISSIKMMQWFRQGWQV
FT                   EVTFEEVRAHLGVETQRQWSDQAILRTTPALLALFSIVTALAHQLQSTHPVACPMTAWY
FT                   RKLNPSFADALAQVRRH"
FT                   /protein_id="YP_001521517.1"
     ATGCCACCGA TTCCCATTCG CTGGGTCTTG ATCCGCGATC CTCAAGGTCG ATGCAAGCCA        60
     CAAGCACTGC TTTGTACAGA CCTAGAGATT AGCTCTATCA AGATGATGCA ATGGTTTCGA       120
     CAAGGTTGGC AGGTTGAAGT CACTTTTGAA GAAGTCCGTG CCCATCTCGG TGTCGAAACC       180
     CAGAGACAAT GGTCAGACCA GGCGATTCTT CGCACCACGC CTGCACTTCT AGCACTCTTC       240
     TCCATTGTGA CCGCCTTAGC CCATCAATTG CAGTCAACAC ATCCAGTCGC TTGTCCCATG       300
     ACAGCTTGGT ACCGAAAACT AAATCCATCA TTTGCAGATG CACTCGCACA AGTTAGGCGG       360
     CACTGA                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page