(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE69

ACAM1_4.PE69         Location/Qualifiers
FT   CDS_pept        complement(71578..71691)
FT                   /locus_tag="AM1_C0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340524"
FT                   /db_xref="GeneID:5686291"
FT                   /translation="MSSNEAALRVTVDEMNPYPSFPDGQSAQQGPTKSTTS"
FT                   /protein_id="YP_001521518.1"
     ttgagtagca atgaagctgc tttaagggta actgtggatg aaatgaaccc atatcctagc        60
     tttccagatg gtcaatcagc tcaacaaggt ccaactaaat caacaacctc ttaa             114
//

If you have problems or comments...

PBIL Back to PBIL home page