(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE7

ACAM1_4.PE7          Location/Qualifiers
FT   CDS_pept        complement(3293..3634)
FT                   /locus_tag="AM1_C0007"
FT                   /gene_family="HOG000022978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340462"
FT                   /db_xref="GeneID:5686229"
FT                   /translation="MDVQLLEVLSIQLNVGDILEIAFTGEEFASEQMIEIPIACKLVKK
FT                   DTLLLYFHPHELDLDLNTLDIHSKKDQRYLTVHSLEIVDAEKGYLATYEEEEFVRYQVM
FT                   WKKIANISD"
FT                   /protein_id="YP_001521456.1"
     atggatgttc aactcctaga agtactctcc atccagctca atgttggcga tatcctagaa        60
     atagctttta ctggtgagga gtttgcatcg gagcaaatga tcgaaatccc aattgcttgc       120
     aagctggtca aaaaggatac ccttctcctt tacttccacc ctcatgaatt ggatttagac       180
     ttgaacacgt tagacataca ctccaaaaaa gaccaacgat atctgactgt ccatagcctg       240
     gagatagttg atgcagagaa aggatatcta gctacctatg aggaggaaga atttgttcgc       300
     tatcaggtga tgtggaagaa aatagcgaac atatctgatt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page