(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE71

ACAM1_4.PE71         Location/Qualifiers
FT   CDS_pept        complement(72074..72199)
FT                   /locus_tag="AM1_C0071"
FT                   /gene_family="HOG000022982" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340526"
FT                   /db_xref="GeneID:5686293"
FT                   /translation="MKSTTPLQADGVWNTICSQTVDLDCNPISSLQAAGNLPPLD"
FT                   /protein_id="YP_001521520.1"
     gtgaaatcaa ctaccccgct gcaagcagac ggggtatgga atacgatttg ttcccaaacc        60
     gtagatttgg attgcaatcc catttcttcg ctgcaagcag cggggaatct acccccacta       120
     gattga                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page