(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE73

ACAM1_4.PE73         Location/Qualifiers
FT   CDS_pept        complement(72416..72661)
FT                   /locus_tag="AM1_C0073"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340528"
FT                   /db_xref="GeneID:5686295"
FT                   /translation="MPDSSNQLKKSCQNCIHLQKLNLSKIVWDGTFLPSYGCGIKGIEN
FT                   HWPDLQAVIVATHLDPQTKAEMIALQCPRFKFVGSL"
FT                   /protein_id="YP_001521522.1"
     atgccagact cctcaaacca actcaaaaag tcttgccaga attgtatcca tttgcaaaaa        60
     ctcaacctta gtaaaattgt ttgggatgga accttcttac catcgtatgg atgtgggatc       120
     aaaggtatag aaaatcattg gcctgatctc caagctgtca ttgttgctac tcatcttgac       180
     ccacaaacga aggcagagat gattgcactt caatgccccc gtttcaagtt tgttggtagc       240
     ctttga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page