(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE74

ACAM1_4.PE74         Location/Qualifiers
FT   CDS_pept        complement(72752..73027)
FT                   /locus_tag="AM1_C0074"
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340529"
FT                   /db_xref="GeneID:5686296"
FT                   /translation="MSIYVGNLSYEVAQEDLRAIFSEYGEVTNVHLPKDRETGKLRGFA
FT                   FVDLGNDADEVKAIEDLDGAEWMGRSLKVNKARPREKNRGSSRKRE"
FT                   /protein_id="YP_001521523.1"
     atgtcgattt acgttgggaa tctctcttac gaagttgctc aagaagatct cagggccatt        60
     ttttctgaat atggagaagt cacaaatgtt catctcccaa aagaccgtga gactggtaag       120
     ttacggggtt ttgcctttgt tgatttgggg aatgatgctg atgaagtcaa agccattgaa       180
     gacctagatg gtgccgaatg gatgggacgt tccctgaaag tgaacaaggc aagacctcga       240
     gagaagaata gaggaagcag caggaaacga gaatag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page