(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE75

ACAM1_4.PE75         Location/Qualifiers
FT   CDS_pept        complement(73270..74019)
FT                   /locus_tag="AM1_C0075"
FT                   /gene_family="HOG000287552" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340530"
FT                   /db_xref="GeneID:5686297"
FT                   /translation="MINPGQAGVVSILGKARDVAFLEGIHFKPPLISAVDVYDVTVQKF
FT                   EVPAQSSTKDLQDLNARFAINFRLDPIQVVEIRRTQGSLENIVTKIIAPQTQESFKIAA
FT                   SRKTVEEAITQRTELKQDFDDVLGARLDKYGIIVLDTSVVDLEFSPEFAKSVEDKQIAE
FT                   QRAKRAIYVAQEAEQEAQAEINRARGKAEAQRLLAETLKAQGGELVLQKEAIQAWREGG
FT                   SQVPEVLVNGGSEQSGVPFLFNIKDAH"
FT                   /protein_id="YP_001521524.1"
     gtgattaatc ccggccaagc tggggttgtc agcattctag ggaaagctag agacgttgca        60
     tttttggaag gaattcactt caaacctccc ttaatatctg ctgtagatgt ttatgacgta       120
     acggtgcaaa aatttgaagt tccagcccaa agttccacta aagatctaca agatttgaat       180
     gctcgttttg ccatcaattt ccggcttgat ccaattcaag tggtggaaat tcgtagaaca       240
     caaggcagcc tagaaaatat agttactaaa atcatagctc cccaaaccca ggaatccttc       300
     aaaattgcag catcaaggaa aaccgttgaa gaggctatta ctcaaagaac agaactaaaa       360
     caagactttg atgatgtctt gggtgcccgg ttagacaaat acggcattat tgttctcgat       420
     accagtgtgg ttgatttaga attttcacct gaatttgcca agtccgtcga agataagcaa       480
     atcgctgaac aaagggctaa acgagcgatt tatgttgctc aagaagcaga acaagaggct       540
     caagccgaga taaaccgagc caggggaaag gctgaagcgc aaagattact cgctgaaacc       600
     ctaaaagctc agggtggtga gttggtgttg caaaaagaag ctatacaggc atggagagaa       660
     ggaggttctc aagtaccaga agttttagta aatggtgggt ctgaacaatc tggcgttccg       720
     ttcctcttca atatcaaaga tgctcattga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page