(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE76

ACAM1_4.PE76         Location/Qualifiers
FT   CDS_pept        complement(74220..75284)
FT                   /locus_tag="AM1_C0076"
FT                   /gene_family="HOG000023001" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340531"
FT                   /db_xref="GeneID:5686298"
FT                   /translation="MTQYSELKSALQPHLNWHGARLSFLTLFLLALFKVKTVNLSELAL
FT                   GFEGSAQSDSKYKRLQRFFRGFDLEYATIAKLVIDWMQTPQPWVLSIDRTTWEFGTHCF
FT                   NILSIGVVHEGVAFPLLWWMLQKKGNSSSDERMRFVEALLHICPDLQIRYLCGDREFIG
FT                   QLWVRYLRLAPLLPFRLRIRATDKIERQGKALQTKVVFAHLQVGQRQRLKGDCRVWGQP
FT                   VAVEGLRLEDGALLVVIGPTQDDQLIDDYALRWGIETLFGIFKTRGFCLESTHFTEAER
FT                   LRKLFALLTLALYWAMKTGLFLHQLKPIALKTHERRAKSLFRLGFDHFRQMILNPSPGN
FT                   EREFLQSLQLLSST"
FT                   /protein_id="YP_001521525.1"
     atgactcaat atagcgaact caaaagtgct ctccaacccc acctgaactg gcatggtgcc        60
     cgtttatcat tcctgacctt gttcttgttg gccttgttta aggtcaaaac cgttaacctg       120
     agtgaattag cactggggtt tgaagggagc gctcaatccg actccaagta caaacgtttg       180
     caacgcttct tccgaggatt tgaccttgag tatgcgacca tcgccaagct ggtcatcgac       240
     tggatgcaaa ctccacagcc atgggtcttg agtattgacc gcaccacctg ggagtttggt       300
     actcactgct tcaacatcct cagcattggt gtcgtccatg agggagttgc tttccctctg       360
     ttgtggtgga tgctccagaa gaaaggcaac tccagtagtg atgaacggat gcgatttgtt       420
     gaagcgctcc tgcatatctg ccctgatctc caaatccgat atttgtgtgg ggatcgagaa       480
     ttcattggcc agctttgggt tcgctattta cgcttagctc cactcttgcc gtttcggctc       540
     agaattcgag cgacggataa aattgagcgc cagggtaagg cccttcaaac caaggtggtc       600
     tttgctcatc tccaagtggg tcaacgccag cgcctgaaag gtgactgccg tgtatgggga       660
     cagccggttg cggtggaagg actgcgcttg gaagatggtg cactgctggt tgtgattggt       720
     ccgacacaag atgaccagct cattgatgat tatgccttgc gatggggaat tgaaaccctc       780
     tttggtattt tcaaaactcg cggtttttgt cttgaatcga ctcactttac tgaagcggaa       840
     cgcttacgaa agctatttgc cctattgact ttggcattgt attgggcgat gaagacaggg       900
     ctgtttttac atcaactcaa acccattgcc ctcaaaaccc atgaacgtcg agcaaagagt       960
     ctattccgtt taggatttga ccattttcgg cagatgattc tcaatccttc tcccggtaat      1020
     gaacgtgagt tcctgcaatc tttacaactt ttgtccagta cttag                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page