(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE77

ACAM1_4.PE77         Location/Qualifiers
FT   CDS_pept        complement(75338..75811)
FT                   /locus_tag="AM1_C0077"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="1A family penicillin-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340532"
FT                   /db_xref="GeneID:5686299"
FT                   /translation="MQLTTSVYVIVTQLRGSLQASAYATFANNGWQSKTTAILQVTDRS
FT                   GKALIDNPPQPKLVLNQWAVASVNSTLQTVVQSGTGIAAQIGRPAAGKTGTTSSERDVW
FT                   FVGYVPQLSVAVWEGNDNYARIGAGATGGGWMAPVWREFMSEALKDLSTGQKA"
FT                   /protein_id="YP_001521526.1"
     atgcaattga caacctctgt ctacgtaatt gtcactcaac tcaggggttc acttcaggcc        60
     tctgcctacg ctacctttgc caataatggt tggcagtcta aaacgactgc tatcctccaa       120
     gtcacggatc gctctggcaa agccttgatt gataaccccc cacaacccaa gttagtactc       180
     aatcaatggg cggtggcctc cgtgaacagc acgttacaaa ccgtcgttca gagtgggacg       240
     ggcattgcgg cccagattgg ccgtccggct gcgggtaaga caggtacaac ttcatctgaa       300
     cgagatgttt ggtttgtggg gtacgttcct caactgtccg tagcggtgtg ggaaggaaat       360
     gacaactacg cccgtattgg agcgggggca acggggggcg gatggatggc acccgtctgg       420
     cgagagttta tgagtgaggc cctcaaggat ctcagtacag gacaaaaagc ttga             474
//

If you have problems or comments...

PBIL Back to PBIL home page