(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE78

ACAM1_4.PE78         Location/Qualifiers
FT   CDS_pept        75949..77679
FT                   /locus_tag="AM1_C0078"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="GI:158340533"
FT                   /db_xref="GeneID:5686300"
FT                   /translation="MPAPIKPQQVHLYMQTKQSGSSQETAAAKAGISTRTAHRIDSGTH
FT                   RPQRGRPHDWKTREDPLDGLWELELEPMLEREPRLEATTLFETLQENHPGQYDDKIRTV
FT                   QRRTAKWKAAHGKPKEVMFKIQHHPGEMGQSDFAQLKGFSVTVQGEAFHHILYHYRLSY
FT                   SGWQYVQVIQGGESFIGLSQGLQNALTACGGVPKIHRTDSLSAAYRNTGGRNPQLTQLY
FT                   STLCDHYRMQPTRNNLGVSHENGGIEGSHGYFKRRLCQALYRRGSFDFDSVAEYQQFIE
FT                   QVIAKLNAKCQKKFALELPTLQPLPRYRTPDYEVRSAKVSCNSTIAVRCVLYTVPSRLI
FT                   GHRLKLHLYHDRLVGFLGTTPVVELARVHVHGSEKKRRARSIDYKHVAESLRRKPNAFL
FT                   YCQWQSELLPNLQWHQLWESLKANFEQDQAARLITEALYIAATQDQESQVADYLQTQLE
FT                   QSTLTLSRLKQAFEFKLSTEQYPDVTSQQHDLSDYDQLLHSRPGQPIPVADDNPKTVAV
FT                   EAFPRRVAEHRASSDSGELVLRPVSVGFSSRRSQPSGAESDFTRSNRSAAALRKVLDQF
FT                   "
FT                   /protein_id="YP_001521527.1"
     GTGCCAGCTC CTATTAAACC TCAACAGGTT CATCTTTATA TGCAGACAAA ACAATCCGGC        60
     TCTTCTCAAG AAACAGCAGC TGCTAAAGCT GGCATTTCTA CCCGCACAGC CCACCGCATT       120
     GATAGTGGTA CTCATCGTCC CCAACGCGGC CGCCCTCATG ACTGGAAAAC CCGTGAAGAT       180
     CCGCTGGATG GATTATGGGA ATTAGAACTT GAGCCGATGT TAGAGCGTGA GCCTCGATTA       240
     GAAGCGACTA CTCTATTTGA GACCTTACAA GAGAACCATC CTGGGCAATA TGATGACAAG       300
     ATCAGAACCG TGCAACGCCG AACCGCTAAA TGGAAGGCAG CTCATGGCAA GCCCAAAGAA       360
     GTGATGTTCA AAATTCAACA TCATCCTGGG GAGATGGGAC AGTCAGACTT CGCTCAGCTC       420
     AAAGGTTTCA GTGTGACGGT TCAGGGTGAA GCCTTTCACC ATATCTTGTA TCACTATCGA       480
     CTGAGCTATA GCGGCTGGCA GTACGTGCAG GTGATTCAAG GCGGAGAAAG TTTTATCGGC       540
     TTATCCCAAG GGCTACAAAA TGCTCTAACC GCCTGTGGTG GCGTGCCCAA GATTCATCGT       600
     ACCGATAGTC TGAGTGCGGC TTATCGCAAT ACTGGCGGCC GCAATCCCCA GCTGACCCAG       660
     TTGTATTCGA CTCTGTGTGA CCATTACCGG ATGCAGCCAA CACGCAACAA TCTGGGTGTC       720
     TCTCATGAGA ATGGCGGAAT AGAGGGGTCT CATGGCTATT TCAAACGACG CCTGTGCCAA       780
     GCCCTGTATC GTCGAGGCAG CTTTGACTTT GACTCGGTAG CTGAGTATCA GCAGTTCATC       840
     GAGCAAGTCA TCGCCAAGCT GAATGCCAAG TGCCAAAAAA AGTTTGCACT GGAGCTGCCC       900
     ACCTTACAGC CCTTGCCCAG ATACCGAACT CCTGATTATG AAGTGCGCAG TGCCAAAGTC       960
     AGCTGCAATA GCACGATTGC CGTCCGCTGT GTCCTTTACA CAGTCCCCTC TCGCTTAATT      1020
     GGCCACCGCT TGAAATTACA CCTATACCAT GACCGCCTTG TCGGTTTCTT AGGCACCACT      1080
     CCCGTAGTGG AATTGGCGCG GGTCCATGTC CATGGCTCTG AGAAGAAAAG ACGCGCTCGC      1140
     AGCATCGATT ACAAGCATGT GGCAGAAAGT CTCAGGAGAA AGCCAAACGC GTTTCTCTAC      1200
     TGCCAATGGC AATCAGAGCT ACTGCCCAAT CTTCAGTGGC ATCAGCTGTG GGAATCACTC      1260
     AAAGCTAATT TTGAGCAGGA CCAGGCCGCA CGATTAATCA CCGAAGCCCT CTATATCGCT      1320
     GCAACTCAAG ATCAAGAATC TCAGGTGGCT GACTACCTAC AAACTCAACT GGAACAGTCC      1380
     ACCCTGACCT TGAGCAGATT AAAACAAGCC TTTGAATTCA AGCTCTCGAC TGAGCAATAT      1440
     CCTGACGTCA CCTCACAACA GCACGATTTA TCTGACTATG ATCAACTCCT CCACAGCAGA      1500
     CCCGGACAAC CCATACCAGT TGCTGATGAC AACCCTAAAA CAGTTGCGGT TGAGGCATTT      1560
     CCTCGACGAG TGGCAGAGCA TCGAGCATCA AGCGACTCAG GAGAATTGGT CCTACGCCCA      1620
     GTTTCTGTTG GCTTTAGCTC AAGGCGAAGC CAGCCGTCGG GAGCAGAATC GGATTTCACG      1680
     CGCTCTAACC GAAGCGCAGC TGCCTTACGG AAAGTCCTGG ACCAATTTTG A               1731
//

If you have problems or comments...

PBIL Back to PBIL home page