(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE79

ACAM1_4.PE79         Location/Qualifiers
FT   CDS_pept        77468..78223
FT                   /locus_tag="AM1_C0079"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="GI:158340534"
FT                   /db_xref="GeneID:5686301"
FT                   /translation="MLMTTLKQLRLRHFLDEWQSIEHQATQENWSYAQFLLALAQGEAS
FT                   RREQNRISRALTEAQLPYGKSWTNFEFAHVPTLNPAALMEFAQTTHWLESGSNILIFGP
FT                   SGTGKTHVSSALGASIIELGKRVKFVTATTLVQQLQLAKLQLELQSLLSKLDRYDLLII
FT                   DDLGYVQKSDVETSVLFELIAHRYERKSLLITANQPFSQWDSIFPNSMMTVAAIDRLIH
FT                   HATIFEMQAESFRKQEAAKHTAKSQKTDS"
FT                   /protein_id="YP_001521528.1"
     TTGCTGATGA CAACCCTAAA ACAGTTGCGG TTGAGGCATT TCCTCGACGA GTGGCAGAGC        60
     ATCGAGCATC AAGCGACTCA GGAGAATTGG TCCTACGCCC AGTTTCTGTT GGCTTTAGCT       120
     CAAGGCGAAG CCAGCCGTCG GGAGCAGAAT CGGATTTCAC GCGCTCTAAC CGAAGCGCAG       180
     CTGCCTTACG GAAAGTCCTG GACCAATTTT GAGTTTGCCC ATGTTCCCAC CCTTAATCCA       240
     GCTGCTCTCA TGGAGTTTGC CCAAACGACT CACTGGCTAG AGTCCGGTAG CAACATTCTA       300
     ATTTTTGGGC CGAGCGGAAC AGGGAAAACA CACGTCAGCT CTGCATTAGG AGCTTCTATT       360
     ATTGAGTTGG GTAAGCGAGT AAAATTTGTC ACAGCCACAA CCCTGGTGCA ACAACTACAG       420
     CTGGCCAAAC TTCAATTGGA ATTGCAGAGT CTCTTGTCCA AACTTGACCG CTATGATCTG       480
     CTTATCATTG ATGATCTCGG TTATGTCCAA AAGTCCGATG TTGAAACCTC GGTACTGTTT       540
     GAGTTGATTG CTCACCGGTA TGAGCGAAAG AGCCTACTCA TCACGGCTAA TCAACCTTTC       600
     AGTCAATGGG ACAGCATCTT TCCTAACTCA ATGATGACCG TGGCTGCCAT TGATCGCTTA       660
     ATTCACCACG CCACCATTTT CGAGATGCAA GCAGAAAGCT TCCGCAAACA AGAAGCGGCC       720
     AAACACACAG CCAAGTCTCA AAAGACTGAC AGCTGA                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page