(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE8

ACAM1_4.PE8          Location/Qualifiers
FT   CDS_pept        complement(3677..3832)
FT                   /locus_tag="AM1_C0008"
FT                   /gene_family="HOG000022979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340463"
FT                   /db_xref="GeneID:5686230"
FT                   /translation="MKFHVAKLLVWNGRSFLMVDIQMTQTQESLGSVIREYVASMGVQL
FT                   VYWCKV"
FT                   /protein_id="YP_001521457.1"
     atgaaatttc acgttgctaa gctcttagtt tggaatggcc gctcatttct aatggtcgat        60
     atccagatga cccaaactca agaaagcctt ggatcggtca tccgagaata cgttgcttcg       120
     atgggtgtgc agttggttta ctggtgtaag gtttga                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page