(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE80

ACAM1_4.PE80         Location/Qualifiers
FT   CDS_pept        complement(78542..79390)
FT                   /locus_tag="AM1_C0080"
FT                   /gene_family="HOG000023132" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase, catalytic region"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340535"
FT                   /db_xref="GeneID:5686302"
FT                   /translation="MVNQLKEHYPIQMICNVIGYSRSRYYYHQNPGKENRKEVILKSAI
FT                   ADVAGRYPTHGYRRITQQLRREGHTVNHKRVSRLMRGMGLLAKQRVQRKRTTNSVHGYK
FT                   RYPNLVKALTMVRPNQVWVADITYIRLREEFVYLAVLMDVFTRGIRGWHLDWTMEKSLT
FT                   ITALEKALLGHTPEIHHSDQGVQYAANDYVKMLEDNDVKISMAAVGKAYENGFAERLMR
FT                   TIKEEEVDLSEYRNFREVNERIEMFLEEVYMKKRIHSSLSYLTPSEFEEKWRYEQENIQ
FT                   M"
FT                   /protein_id="YP_001521529.1"
     atggtaaatc aactcaaaga acactatccc attcagatga tttgtaatgt gattggatac        60
     agtagaagtc gatattacta ccatcaaaat ccagggaagg aaaatcggaa agaagtaatt       120
     cttaaatctg cgattgcaga tgtagcaggt cgatatccga cccatggcta tcggcgtatt       180
     actcagcaat tacgtcgtga aggccacacc gtcaatcaca agcgagtcag tcgtttgatg       240
     cgaggaatgg ggttacttgc taaacagcgg gtccagcgga agcgaaccac caatagtgtt       300
     catgggtaca aacgatatcc taatctagtg aaggccctaa cgatggtgcg tcccaaccaa       360
     gtatgggtag ccgatatcac ctatatccga ctccgagaag agtttgtgta cctagcggta       420
     ttgatggatg tctttacgcg gggaattcgg ggttggcatt tggattggac gatggaaaag       480
     agcttgacga ttacagccct ggaaaaagct ttgcttggcc acaccccaga gattcatcat       540
     tcagatcaag gtgtccaata tgctgcaaat gactatgtca aaatgctgga ggataacgat       600
     gtcaaaatca gtatggctgc agtaggaaaa gcctatgaaa atggttttgc agaacgactg       660
     atgagaacca ttaaagaaga ggaagttgac ttatcagaat atcgaaattt tagagaggtc       720
     aatgaacgaa tagaaatgtt cttggaagag gtatacatga agaagagaat tcattcatca       780
     ttgagctatt taacaccgag tgaatttgaa gaaaagtgga ggtatgaaca agagaatatt       840
     cagatgtga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page