(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE81

ACAM1_4.PE81         Location/Qualifiers
FT   CDS_pept        complement(79384..79644)
FT                   /locus_tag="AM1_C0081"
FT                   /gene_family="HOG000266649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340536"
FT                   /db_xref="GeneID:5686303"
FT                   /translation="MVLEVVSGQRTPTETCRAHKIHMSVLSRWRNEFLKQAYRAFGTQE
FT                   VNDKASERIAELERMIGRLTMELEVAKKASDMWNLNENMKW"
FT                   /protein_id="YP_001521530.1"
     gtggtactgg aagtggttag tggtcagcga acaccgactg aaacctgtcg agcccacaaa        60
     attcatatgt ccgtgctcag ccgctggcgg aatgaatttc tcaaacaggc ttatcgtgct       120
     tttggaaccc aagaagtcaa cgataaggca tcagaacgaa ttgctgaatt ggagcggatg       180
     attggtcgat taacgatgga gctagaagta gcaaaaaagg cttccgacat gtggaatctc       240
     aacgaaaata tgaaatggta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page