(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE82

ACAM1_4.PE82         Location/Qualifiers
FT   CDS_pept        complement(81706..81828)
FT                   /locus_tag="AM1_C0084"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340537"
FT                   /db_xref="GeneID:5686305"
FT                   /translation="MNFWADLWGGKDFFADHVVTSQALVKEPVISADLEGFWGR"
FT                   /protein_id="YP_001521531.1"
     atgaattttt gggccgattt gtggggcgga aaggacttct ttgctgatca tgtcgtcacc        60
     tcgcaagcac tggtaaagga acctgtgatt tctgctgacc tagagggttt ctggggacgc       120
     tga                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page