(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE9

ACAM1_4.PE9          Location/Qualifiers
FT   CDS_pept        complement(4020..4808)
FT                   /locus_tag="AM1_C0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340464"
FT                   /db_xref="GeneID:5686231"
FT                   /translation="MQNQLEGSKWMANFQEIHAHMEFEEWAYQQGLQDSEKYLIETYLD
FT                   KSGKTVEAGTGGGRILLAMQNLGFKHLYGFDYLTDFIDAATKNDQTQQIIFTAQNASQL
FT                   NYQDCFFDNAIYLQQVVCYPDSDTERLKVLQEAYRILKVGGIAIFSVLLFDARLKSLAY
FT                   SLFIQYIRLLRVLRFSQRSIQYLPSLQIQRQNNYSALLDAPPYMYWYKMEEFYRALTEL
FT                   NFEVIAMGTNHQVDCRKTSDTPTELAQLSLGNQLYCVCRK"
FT                   /protein_id="YP_001521458.1"
     ttgcaaaatc aacttgaagg tagtaaatgg atggctaatt ttcaagaaat ccatgcacat        60
     atggagtttg aagaatgggc ttatcagcag ggactacaag atagtgagaa atatcttatt       120
     gaaacttatt tagataaatc agggaaaacg gttgaggctg gtacaggtgg tggccggatt       180
     ttgctggcga tgcaaaatct tggctttaag catctctatg gatttgatta cttgactgat       240
     tttattgatg ctgcaacaaa aaatgatcaa actcagcaaa ttatctttac tgctcagaat       300
     gctagccagt taaattatca agattgtttt tttgataacg ctatttattt acagcaagtc       360
     gtttgctatc ccgatagtga cactgaacgc ctcaaagtac ttcaggaggc ttaccggatt       420
     ctcaaagtag gtggaatcgc aatattttct gtcctactat tcgatgcacg attgaaaagt       480
     ttagcctact ccctatttat tcagtacatc cgtctattaa gagtgttgcg tttctctcaa       540
     cgctcaattc agtatttacc ctcgttacaa atccaacgcc agaacaacta ttcagcctta       600
     ctagatgccc ctccctatat gtattggtac aagatggaag agttttaccg agctttgaca       660
     gaactgaatt ttgaagtaat tgcaatggga accaatcatc aagtagactg ccgaaaaact       720
     agtgatactc cgacagagtt agctcaatta tctttgggga atcagcttta ttgcgtgtgt       780
     aggaagtaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page