(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_5

ID   ACAM1_5; SV 1; empty ; DNA; empty ; PRO; 226680 BP.
XX
AC   NC_009929;
XX
PR   Project: 58167;
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB4, complete sequence.
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Acaryochloris.
XX
RN   [1]
RP   1-226680
RX   PUBMED; 18252824.
RA   Swingley,W.D., Chen,M., Cheung,P.C., Conrad,A.L., Dejesa,L.C., Hao,J.,
RA   Honchak,B.M., Karbach,L.E., Kurdoglu,A., Lahiri,S., Mastrian,S.D.,
RA   Miyashita,H., Page,L., Ramakrishna,P., Satoh,S., Sattley,W.M., Shimada,Y.,
RA   Taylor,H.L., Tomo,T., Tsuchiya,T., Wang,Z.T., Raymond,J., Mimuro,M.,
RA   Blankenship,R.E. and Touchman,J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105 (6), 2005-2010 (2008)
XX
RN   [2]
RP   1-226680
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (17-OCT-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-226680
RA   Touchman,J.;
RT   "Direct Submission";
RL   Submitted (25-SEP-2007) Translational Genomics Research Institute, 13208 E
RL   Shea Blvd, Scottsdale, AZ 85004, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000841.
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..226680
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:329726"
FT                   /note="type strain of Acaryochloris marina"
FT                   /strain="MBIC11017"
FT                   /plasmid="pREB4"
FT                   /organism="Acaryochloris marina MBIC11017"
FT   gene            566..853
FT                   /db_xref="GeneID:5686421"
FT                   /locus_tag="AM1_D0001"
FT   CDS_pept        566..853
FT                   /locus_tag="AM1_D0001"
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340644"
FT                   /db_xref="GeneID:5686421"
FT                   /translation="MSIYVGNLSYDVTQDEIQAVFAEYGAVSNVHVPKDRETGRMRGFA
FT                   FVELGNDAEESKAIEELEGAEWMGRTLKVNKARPRENNRGNNNFSGRNRF"
FT                   /protein_id="YP_001521812.1"
FT   misc_feature    569..793
FT                   /note="RRM (RNA recognition motif), also known as RBD (RNA
FT                   binding domain) or RNP (ribonucleoprotein domain), is a
FT                   highly abundant domain in eukaryotes found in proteins
FT                   involved in post-transcriptional gene expression processes
FT                   including mRNA and rRNA...; Region: RRM; cd00590"
FT                   /db_xref="CDD:100104"
FT                   /locus_tag="AM1_D0001"
FT   misc_feature    order(575..577,695..697,701..703)
FT                   /note="RNA/DNA binding site; other site"
FT                   /db_xref="CDD:100104"
FT                   /locus_tag="AM1_D0001"
FT   misc_feature    785..793
FT                   /note="RRM dimerization site; other site"
FT                   /db_xref="CDD:100104"
FT                   /locus_tag="AM1_D0001"
FT   gene            complement(928..1164)
FT                   /db_xref="GeneID:5686427"
FT                   /locus_tag="AM1_D0002"
FT   CDS_pept        complement(928..1164)
FT                   /locus_tag="AM1_D0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340645"
FT                   /db_xref="GeneID:5686427"
FT                   /translation="MLVDVCQTLRWETPVYTMVSSDEWFICECELSVLGQQLEGSGVAK
FT                   KKKLAKSIAAREILEQLRERGQQQLQEWLERAT"
FT                   /protein_id="YP_001521813.1"
FT   gene            complement(1331..3244)
FT                   /db_xref="GeneID:5686428"
FT                   /locus_tag="AM1_D0003"
FT   CDS_pept        complement(1331..3244)
FT                   /locus_tag="AM1_D0003"
FT                   /gene_family="HOG000023007" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="exoribonuclease II"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340646"
FT                   /db_xref="GeneID:5686428"
FT                   /translation="MPSSTLEKLSQLRSQLQQCSNPTAAKVLKSAIKKLEAQLDPGQSK
FT                   TTASKIAQRKAALRHSKKQAKQKSLQQERTTLKPPLSQKLESKPEGVLQHKKPITLDQE
FT                   KPIEQAKSTAAVQDEKPKPLTQDSPPAKTETTPKSKNRFSPDVIKIAKRLVLADELWER
FT                   PQVQGITIDGPTSRDLDDAIWIEATESGVVLSVHIADVSELVEMGSILDKVALSRTVTR
FT                   YFSNGNAPMLPRPLSENKLSLLEGEARPTVTVQVTLNPNAQMVDVKIFESWLVSHKRFT
FT                   YAEASQPKSSTPFHNTLEMAHQWASHLYRNRLTSGSIGATQTAQGQWLTEEGSLIQGKL
FT                   HPSHILIQEFMILANLAVAQWLADQDIPALYRNHTARAIAPDRETMYQMLLMLGSNAAI
FT                   RQRLHSWMNRAVYSPVLIGHFALNLPAYCHFTSPIRRVADLINHRIVKARLKQQDLPYT
FT                   QSELEELGQHIAQVKDEHKEQASEFFKAAHQKVYQEQLQTPEDLANLTGKEFTRLLKYA
FT                   VESQGVDHLRSELVNRLDAEQLAVQDLYLLLFQSKELELHQQVIQYLSSHIHDAASVIT
FT                   IASNREGNWEAFKYLEAENKPPFHVWLEVKISGDTLTTIHPATHSRKQPARHHACLIWI
FT                   EA"
FT                   /protein_id="YP_001521814.1"
FT   misc_feature    complement(1901..2740)
FT                   /note="RNB domain; Region: RNB; pfam00773"
FT                   /db_xref="CDD:144391"
FT                   /locus_tag="AM1_D0003"
FT   gene            3374..3568
FT                   /db_xref="GeneID:5686429"
FT                   /locus_tag="AM1_D0004"
FT   CDS_pept        3374..3568
FT                   /locus_tag="AM1_D0004"
FT                   /gene_family="HOG000023216" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340647"
FT                   /db_xref="GeneID:5686429"
FT                   /translation="MNHCAFQTSHQAKDLRHTQDGQAIAEFVVTIPPLREEDPPENLKA
FT                   IYWGENGETPTFPYNLATN"
FT                   /protein_id="YP_001521815.1"
FT   gene            3715..3855
FT                   /db_xref="GeneID:5686430"
FT                   /locus_tag="AM1_D0005"
FT   CDS_pept        3715..3855
FT                   /locus_tag="AM1_D0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340648"
FT                   /db_xref="GeneID:5686430"
FT                   /translation="MLSQQVKVKLRVARPILEPLLFTKGMMMKSSRNAECSPLMIRYKG
FT                   S"
FT                   /protein_id="YP_001521816.1"
FT   gene            3923..4714
FT                   /db_xref="GeneID:5686431"
FT                   /locus_tag="AM1_D0006"
FT   CDS_pept        3923..4714
FT                   /locus_tag="AM1_D0006"
FT                   /gene_family="HOG000023000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340649"
FT                   /db_xref="GeneID:5686431"
FT                   /translation="MAPDNKYSTVLLELKTHYQETLAELEAQTSQLKTKITSLDTLIED
FT                   PLLGSDILSILQGEADSLTSPEPVSKTADTVELKAKSKKATPKAASKKKSTPPKKPAST
FT                   AKTKEKVKPEVDAEATPKKAAQKASPSSGKRKSSTSKKAVSQATAKKKSQKKTSSSSSS
FT                   VLTMNKPYDQMKKIDAITQIMQENPGKVMHYDDLIVRLFGELSKDDQKAERGRIKAAMY
FT                   QGAKNNLWKKANVPMCYIYDPSLKAESKATTSKTQKSRKKT"
FT                   /protein_id="YP_001521817.1"
FT   gene            complement(4747..5229)
FT                   /db_xref="GeneID:5686432"
FT                   /locus_tag="AM1_D0007"
FT   CDS_pept        complement(4747..5229)
FT                   /locus_tag="AM1_D0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340650"
FT                   /db_xref="GeneID:5686432"
FT                   /translation="MSSKNLQISQPRTPRESVELELSAGSDVMESNLSGEILGLSMYQQ
FT                   TAWSIHETLRMCLDLVAEEHWFMNNLLPFQAISPHKIRVFHPKSFEDAEEAINAMKTDD
FT                   MLLVNLAALETKLAQRLTDYLAGSTFALSGEQMEIGRGIFLFAPPSFLISRMMASA"
FT                   /protein_id="YP_001521818.1"
FT   misc_feature    complement(4768..4986)
FT                   /note="Protein of unknown function (DUF552); Region:
FT                   DUF552; cl00775"
FT                   /db_xref="CDD:153987"
FT                   /locus_tag="AM1_D0007"
FT   gene            complement(5274..6101)
FT                   /db_xref="GeneID:5686433"
FT                   /locus_tag="AM1_D0008"
FT   CDS_pept        complement(5274..6101)
FT                   /locus_tag="AM1_D0008"
FT                   /gene_family="HOG000023217" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340651"
FT                   /db_xref="GeneID:5686433"
FT                   /translation="MVKDNDQTTKQYSSKDLKQRKTWYSPAAEAYNRTRPHYPDTLISR
FT                   VVELTQLENGSRILEIGCGPGTATVSFANLGFSMLCLEPNPDFYEIARRNCSHYPNLEI
FT                   KNTSFEEWKPEAKPFNAVLAATSIHWIPAEVAYPKVANALQDNGVLILLWNVPAIPYRE
FT                   FHQVLQDVYQIHAPSLSHYKGRETHEAELRELGQIVATSDQFEGIVFEQIIWETSYSVD
FT                   EYLTLLSTFSQYLELDEKSRKDLFVGLQKKIDNHFAGHIKLLNISAFHIARKR"
FT                   /protein_id="YP_001521819.1"
FT   misc_feature    complement(5331..6005)
FT                   /note="Trans-aconitate methyltransferase [General function
FT                   prediction only]; Region: Tam; COG4106"
FT                   /db_xref="CDD:33863"
FT                   /locus_tag="AM1_D0008"
FT   misc_feature    complement(5646..5933)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="AM1_D0008"
FT   misc_feature    complement(order(5727..5729,5775..5783,5850..5855,
FT                   5901..5921))
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="AM1_D0008"
FT   gene            6377..6619
FT                   /db_xref="GeneID:5686434"
FT                   /locus_tag="AM1_D0009"
FT   CDS_pept        6377..6619
FT                   /locus_tag="AM1_D0009"
FT                   /gene_family="HOG000023004" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340652"
FT                   /db_xref="GeneID:5686434"
FT                   /translation="MTDFKHRPTNLGQHLWSPRNLAEQTHAAAQSAELHSRSVGQASLS
FT                   QKLLDIQRQLCILQLRLKDPEIQEWTGKQMQLPFR"
FT                   /protein_id="YP_001521820.1"
FT   gene            complement(6659..6802)
FT                   /db_xref="GeneID:5686435"
FT                   /locus_tag="AM1_D0010"
FT   CDS_pept        complement(6659..6802)
FT                   /locus_tag="AM1_D0010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340653"
FT                   /db_xref="GeneID:5686435"
FT                   /translation="MGAGSGVLGLKGLSYLVLSCLVGLSILLFQGKKPQFSVILNERWR
FT                   CI"
FT                   /protein_id="YP_001521821.1"
FT   gene            complement(7037..7780)
FT                   /db_xref="GeneID:5686436"
FT                   /locus_tag="AM1_D0011"
FT   CDS_pept        complement(7037..7780)
FT                   /locus_tag="AM1_D0011"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two-component transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340654"
FT                   /db_xref="GeneID:5686436"
FT                   /translation="MPEFMNNQSNKQHSILVVDDEGPIRRILDTRLSMMGYHVFTAADG
FT                   VEALEIFDRQHPDLIVLDVMMPRLDGYGVCRAIRKTSRVPIIMLTALSEVGDRVTGLEM
FT                   GADDYMVKPFSPKELESRVRCIIRRMGSLKPFNYRVTGVLNIGSLRIDTNKRKVFRGQE
FT                   RIILTHMEFSLLELLASTPGAVVSRQELLEKVWGYSNGTIVDSRVVDVHVSRLRNKLKA
FT                   NQVGTELIHTIRGVGYTLKCEQSPN"
FT                   /protein_id="YP_001521822.1"
FT   misc_feature    complement(7067..7759)
FT                   /note="Ycf27; Reviewed; Region: orf27; CHL00148"
FT                   /db_xref="CDD:164540"
FT                   /locus_tag="AM1_D0011"
FT   misc_feature    complement(7400..7735)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_D0011"
FT   misc_feature    complement(order(7442..7447,7454..7456,7511..7513,
FT                   7568..7570,7592..7594,7721..7726))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_D0011"
FT   misc_feature    complement(7592..7594)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_D0011"
FT   misc_feature    complement(order(7568..7576,7580..7585))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_D0011"
FT   misc_feature    complement(7439..7447)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_D0011"
FT   misc_feature    complement(7061..7351)
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="AM1_D0011"
FT   misc_feature    complement(order(7070..7072,7085..7087,7121..7126,
FT                   7148..7150,7157..7159,7217..7222,7277..7279))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="AM1_D0011"
FT   gene            complement(7940..8554)
FT                   /db_xref="GeneID:5686437"
FT                   /locus_tag="AM1_D0012"
FT   CDS_pept        complement(7940..8554)
FT                   /locus_tag="AM1_D0012"
FT                   /gene_family="HOG000022997" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340655"
FT                   /db_xref="GeneID:5686437"
FT                   /translation="MTPPIVALNPKLVPKTIIPQLPKSVPSLPKLVSRTAFPKKTPEGT
FT                   RPAKLEQGHEELGGLRRSSRRTHRSAKPEYSPKTQTSEAAQTSQPRTPRVSAELERRFK
FT                   NLELKQKNLVEQTRTRGELEYLAVSKNESEEYLITVAGTGKPFVRNTFATPEFCWECAV
FT                   EIEENFEIGEVIELRPPETMERIGEMVGVWLERERVTRVWG"
FT                   /protein_id="YP_001521823.1"
FT   gene            complement(8582..8860)
FT                   /db_xref="GeneID:5686438"
FT                   /locus_tag="AM1_D0013"
FT   CDS_pept        complement(8582..8860)
FT                   /locus_tag="AM1_D0013"
FT                   /gene_family="HOG000022999" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340656"
FT                   /db_xref="GeneID:5686438"
FT                   /translation="MNNLVIFPGQSSSEIYLSNPSSFREAKEAAHCLKNGQLLLVNLEN
FT                   LSPKSAQRISDYLAGCTNSLCGEYTEIGNGVYLFAPQTFPIVKQSKY"
FT                   /protein_id="YP_001521824.1"
FT   misc_feature    complement(8618..>8860)
FT                   /note="Protein of unknown function (DUF552); Region:
FT                   DUF552; cl00775"
FT                   /db_xref="CDD:153987"
FT                   /locus_tag="AM1_D0013"
FT   gene            complement(8980..9108)
FT                   /db_xref="GeneID:5686439"
FT                   /locus_tag="AM1_D0014"
FT   CDS_pept        complement(8980..9108)
FT                   /locus_tag="AM1_D0014"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340657"
FT                   /db_xref="GeneID:5686439"
FT                   /translation="MFSAVDGITGSRLGSIEEESEDGGCGDVVEESRGRSMSHFTL"
FT                   /protein_id="YP_001521825.1"
FT   gene            complement(9069..9446)
FT                   /db_xref="GeneID:5686440"
FT                   /locus_tag="AM1_D0015"
FT   CDS_pept        complement(9069..9446)
FT                   /locus_tag="AM1_D0015"
FT                   /gene_family="HOG000022996" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340658"
FT                   /db_xref="GeneID:5686440"
FT                   /translation="MIESRPSLSLNVLLTEEQLGFLDYLYPNDDPEDALIRLLERARNR
FT                   AIRKAEQQVHILHPRQEEAEQPETSPDQPNSQVDEQVENPIGQLQELCQKQQISLPRYE
FT                   FSEISEGFRCLVQSMGLQGVG"
FT                   /protein_id="YP_001521826.1"
FT   gene            complement(9443..10519)
FT                   /db_xref="GeneID:5686441"
FT                   /locus_tag="AM1_D0016"
FT   CDS_pept        complement(9443..10519)
FT                   /locus_tag="AM1_D0016"
FT                   /gene_family="HOG000022995" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340659"
FT                   /db_xref="GeneID:5686441"
FT                   /translation="MPSASIDKLNQLKRQLQDCINPTAAKLLKSTIAKLEAQLNLGQDQ
FT                   IELSKIDQLKTTNTNSFKVAQRKAAHKKSERKSRQKASQKQRTTLKPPSLNKIEPKPEV
FT                   ISQSKKLPNPAQEKPHVKTVDTPNSKNSNSKNQKQEKTTSKSKSGELSEKPPLLPGNGT
FT                   HRAWCRIPGIIRVREKEFDDGRTKSLYFVEVDGQPIKLFLSKKSFKKVKSVLDKPIMVF
FT                   GYPNIMNGQITSLQLTGTSQRASAKTENWVLIGVWRADKQRVLIQRDQERDPEIHIRQH
FT                   SPLVSEDCLETLKDGKLYEFICHRDGVTVKVVAVGERSTPKSNATESTDQEITDPEIKD
FT                   QNIIDQVLSKLESSTLQV"
FT                   /protein_id="YP_001521827.1"
FT   gene            10641..10832
FT                   /db_xref="GeneID:5686442"
FT                   /locus_tag="AM1_D0017"
FT   CDS_pept        10641..10832
FT                   /locus_tag="AM1_D0017"
FT                   /gene_family="HOG000023216" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340660"
FT                   /db_xref="GeneID:5686442"
FT                   /translation="MNHFAIQGILLERSLRYTQERRAIAEFVVEINPLREEDPKENLKA
FT                   IYWGENGEKAHNALHTLG"
FT                   /protein_id="YP_001521828.1"
FT   gene            complement(11014..11559)
FT                   /db_xref="GeneID:5686443"
FT                   /locus_tag="AM1_D0018"
FT   CDS_pept        complement(11014..11559)
FT                   /locus_tag="AM1_D0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340661"
FT                   /db_xref="GeneID:5686443"
FT                   /translation="MKIYTPSFEELNFCYELEKSFPSNSEDANAKGFFLPGASFKVYED
FT                   LHDTGYIKVLSQDSNLVGFVMVVPPKHQILSRLLINNESLIWFDSEQLYPNVDNCYWIA
FT                   KIAVKAEFMRMGYAKALYDDVFLNFDGLTALTATAVSPLRNHASENFHRALGLKACGLF
FT                   LSGTKGELTNIVNILWRK"
FT                   /protein_id="YP_001521829.1"
FT   gene            complement(11534..12232)
FT                   /db_xref="GeneID:5686444"
FT                   /locus_tag="AM1_D0019"
FT   CDS_pept        complement(11534..12232)
FT                   /locus_tag="AM1_D0019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340662"
FT                   /db_xref="GeneID:5686444"
FT                   /translation="MQALSILIRDAWLSILENPTILRCVIHQLIRQEDYIETLSRITGI
FT                   SRLTYKKEPFTFEQLVKDDRLIIKHQANEIDFKKTDVGSILKLRHQVLRNGYPITEVMF
FT                   NEDHDYQSRHYGAFDRQENNICCVSLIQSYWNGFLAWQLRAMATAPEWRSKGIGRKIID
FT                   FMISDLEKDEQLRHIWCNCRVQSSGFYKKMGWREASNQFINGNAGLSVKMVREFFKTSH
FT                   SNNENLHTII"
FT                   /protein_id="YP_001521830.1"
FT   misc_feature    complement(11645..11833)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="AM1_D0019"
FT   gene            complement(12250..13560)
FT                   /db_xref="GeneID:5686445"
FT                   /locus_tag="AM1_D0020"
FT   CDS_pept        complement(12250..13560)
FT                   /locus_tag="AM1_D0020"
FT                   /gene_family="HOG000023165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340663"
FT                   /db_xref="GeneID:5686445"
FT                   /translation="MSASRSPEPTIGFVDEYCQLFAELFPQVRSYEAFKHLHLGMISDI
FT                   KRKSLPAIARAVGLENHQSLHHFLSESPWVASHLSDKRLDIILKILDGRRLILLIDETG
FT                   DCKKGKSTDYVKRQYIGNVGKKENGIVAVTAYGLFQGMILPLSFEVYKPRERLKEEDEY
FT                   LSKPQIAAGMIRQLQGMGFCFELVLADSLYGEAQTNFVNVLEELKLPYILAIRSNHAVW
FT                   LPAEQAVFAEPWQSFERTFSNGTTETRYRQEIIYGQRHHQKRYWLLTTDPQTLPENSTS
FT                   YVMAAAPEIKLDEIGDCYGFRTWIEYGLKQSKDTLGWADFRMTHYEQIEKWWEIVMSAF
FT                   LMVSLFADVFNDSCPVAHQHFAQHPWWDNQNGWKNLLNNVRLIIQPLISWNLLKRWLEV
FT                   FPSRALKKGFEQLTSKMEAFCCPLVRKLLKHPDFLSV"
FT                   /protein_id="YP_001521831.1"
FT   misc_feature    complement(12415..13533)
FT                   /note="FOG: Transposase [DNA replication, recombination,
FT                   and repair]; Region: COG5659"
FT                   /db_xref="CDD:35218"
FT                   /locus_tag="AM1_D0020"
FT   gene            complement(13608..15005)
FT                   /db_xref="GeneID:5686446"
FT                   /locus_tag="AM1_D0021"
FT   CDS_pept        complement(13608..15005)
FT                   /locus_tag="AM1_D0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340664"
FT                   /db_xref="GeneID:5686446"
FT                   /translation="MPRISYGPAQKTRVLRILECILRFANDEFEHTQKINIQYSWQEDG
FT                   LQEKTLIVKTTINNLKYLCDHYDLRNPLQKTDIRDALHCLKDFLGILQDHRVNKQGSQD
FT                   WHFSLELWSKKTDINLNEVNSLWEKNKSNRSKKASISNKRDNQLNNIPENYANSSIKKI
FT                   SHLKKFNIDTRFNKFPIPFNIEENLIWLEKIYFEEIILMLNITDIFSRAAYSKRIKDAE
FT                   NDSSFLAFTKSKESLVCDQEKKLNRTTRLGWNLEQATRVINENPIHLVVSPAHAGTLAI
FT                   LTYLREKNINITFDYHHPHSVEIVENAIFDNFSRQVDGFTLTLATASVLLREKTGRYTS
FT                   SFMMPNMTHGILSSNIELNERSLDGEYLLMKEVPSTEFFIYENLINSKLLTKSTTTEME
FT                   PDEVTHALSNGDSNIRTIIGFPHYNFNLKFNSCNLLNNPIAQIKPVFLFLRSSIIVKSD
FT                   IIPLLSL"
FT                   /protein_id="YP_001521832.1"
FT   gene            15294..15617
FT                   /db_xref="GeneID:5686447"
FT                   /locus_tag="AM1_D0022"
FT   CDS_pept        15294..15617
FT                   /locus_tag="AM1_D0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340665"
FT                   /db_xref="GeneID:5686447"
FT                   /translation="MSIHRYDLQLTENLSISKIKIDQEIQVLSKSNDAVISEFAEAMRK
FT                   GADFPPITVFYDGSEYWLADGFSRIKAKEANGDSYILAEVEFGSRHEAKLYAVVTNTNQ
FT                   KSN"
FT                   /protein_id="YP_001521833.1"
FT   gene            16057..17118
FT                   /db_xref="GeneID:5686448"
FT                   /locus_tag="AM1_D0023"
FT   CDS_pept        16057..17118
FT                   /locus_tag="AM1_D0023"
FT                   /gene_family="HOG000022994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340666"
FT                   /db_xref="GeneID:5686448"
FT                   /translation="MPPKKASRELHEVSTQSVEIAEIRMDGGTQPRAKLFEEVVDDYAQ
FT                   DMKQGATFPPVIVYFDGEEYWLADGFHRVRAKEAIGETSVTAEVHLGTQRDAVLYAVGA
FT                   NAAHGLRRTNADKRRAVIRLLRDFEWREWSDREIARRCGVDHKTVGSLRKDIYPTDDQS
FT                   KEFRKGADGRITNVSNIGKSTKTINESNKRQRRKKPAATLNTIVEQSQKVQIDDIWRLG
FT                   KSHLLFCGDSGSAKFQKLLPIEISLLLFFPRKDKPWLPEKPTNVHNTLLFHTSYGEDLH
FT                   LETLRGIIENCLSGTTDANDPIVMINLIDPSLFILIDELECSCFCAEPDPQRCTDALTV
FT                   WTAINQTVKKIST"
FT                   /protein_id="YP_001521834.1"
FT   misc_feature    16105..16371
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="AM1_D0023"
FT   gene            17774..17908
FT                   /db_xref="GeneID:5686449"
FT                   /locus_tag="AM1_D0024"
FT   CDS_pept        17774..17908
FT                   /locus_tag="AM1_D0024"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340667"
FT                   /db_xref="GeneID:5686449"
FT                   /translation="MGASPCLAFKIFRVNYLQPTAPTPATSVGISQANAERQATSISA"
FT                   /protein_id="YP_001521835.1"
FT   gene            17905..21312
FT                   /db_xref="GeneID:5686450"
FT                   /locus_tag="AM1_D0025"
FT   CDS_pept        17905..21312
FT                   /locus_tag="AM1_D0025"
FT                   /gene_family="HOG000023186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340668"
FT                   /db_xref="GeneID:5686450"
FT                   /translation="MTLSGQIEGYRYLGQSKDGLWGKYVLNDGKDLSHEDRERRWQEQR
FT                   ILREQRAQAEAHRHAQSLPAIERDRLYRQLLDQLTLHPADRADLHRRGFTNEQIQDWGV
FT                   KSVEQWQPLSGELPHDLPGINLDGKSLNTPRPGYLCPIMDADGQIVGFQIRSRSSEGGR
FT                   YFWLTGKTRKRPNGPTPHLRNGELPLAIHRPEQITRDAFALVEGTGAKPHLLAQRMGQV
FT                   TIGAAGGLFAASPETLKATLAQLGITTIEFYPDAGAIQNKSVLRQYRVTWALLKEWGYT
FT                   VTVAWWKQTDKRIHTDIDELDDLSQIQYLSVADFERITAQCNGLLHQLQQALSKLTRPS
FT                   SPAQGFATPNDQQTHPTESRRTKRTAPDDERLATLPATSRRARRSRRRTARLLAAHRRH
FT                   GYISKLRLENYRSRIRRRAAQSANSRSSSLQSCPEDNGTLETTTPLVQEYEPGQRLQTW
FT                   ETLISSGFPYILDQSQPGTGKSYDSGNVTPIGFGMEQVIYLSDQHRNPTVSTLEQGNGW
FT                   CDLEARHGGLNRVKNRLQRSAKGDAFAVPANCSRIGVLNALRDKNIPGADTANLICGTC
FT                   IAREACINANGPGYGFLNQRRNVLGAPLLRAHPDSLPDPEDYPLENTMLIWDEPGQNFQ
FT                   VKQSTTVTLTDLQQTISALITYPEIFALVQPLLSALLPLMDGSMKLGKYGLNHLALKSR
FT                   LPDMAGVKLGEIALILMPNLGFLNTTSDYGIDLADLPKQLRKKFTERDSEMAEQARNGV
FT                   VKQWLIPLIRILQGGAGCIQVSRYGLLTLNTPNPRHRDLAQAAQANVFLDATLSREDLA
FT                   LKLGCSPDEILVVRQAIPDTGNLEVIQVKDMGRVGMSRGGDQLKRIGALAQHYQDLDAA
FT                   NTRTIDFKKFEKDGAWWRDSRGVNDFLTVQTLVLVGTPCRNLNDLAAEFAIVCGYYPED
FT                   DNPAFTAFIDRSILAEIHQAIGRLRAHRRPNESLQVVLISNIEMDCFVQEVQAKDLTIE
FT                   AAHKTERVEIAIESAILQLQAKGEKVTQQIVSAMTQIPRGTIARYWRLFISLLESLNSR
FT                   MNNSSNAPNPDQETHQAIAGVLDELADLPVNDLLPSLNEVFFDWLKPKEWSSVWSEVSA
FT                   SSQMAILEGLAMTLPAKMLERGMPELAA"
FT                   /protein_id="YP_001521836.1"
FT   gene            21529..21681
FT                   /db_xref="GeneID:5686451"
FT                   /locus_tag="AM1_D0026"
FT   CDS_pept        21529..21681
FT                   /locus_tag="AM1_D0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340669"
FT                   /db_xref="GeneID:5686451"
FT                   /translation="MLLEFAAQRFLLKILAIVTDCIFCFDVLPLLALKYTQVNQSTIPS
FT                   PKFFN"
FT                   /protein_id="YP_001521837.1"
FT   gene            21888..22310
FT                   /db_xref="GeneID:5686452"
FT                   /locus_tag="AM1_D0027"
FT   CDS_pept        21888..22310
FT                   /locus_tag="AM1_D0027"
FT                   /gene_family="HOG000023218" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340670"
FT                   /db_xref="GeneID:5686452"
FT                   /translation="MLTVNTQKVTATPVSDLTAMSPDEATEVYQQQYRETYVDLAIQAQ
FT                   EHLGLPVLKTFGELFQLGCTDPELSNSIDQEIAHNPILTDWPMQDSDCIGLISQGPYVQ
FT                   SQINFHGVPVRDVMEYVCDLFRETPEPNAALDDVAA"
FT                   /protein_id="YP_001521838.1"
FT   gene            22327..22482
FT                   /db_xref="GeneID:5686453"
FT                   /locus_tag="AM1_D0028"
FT   CDS_pept        22327..22482
FT                   /locus_tag="AM1_D0028"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340671"
FT                   /db_xref="GeneID:5686453"
FT                   /translation="MADQQGIHVDPQPSSGSTYTDFLNTLHLLGVSVCFDASKSKFNLL
FT                   ELSDNR"
FT                   /protein_id="YP_001521839.1"
FT   gene            22553..23875
FT                   /db_xref="GeneID:5686454"
FT                   /locus_tag="AM1_D0029"
FT   CDS_pept        22553..23875
FT                   /locus_tag="AM1_D0029"
FT                   /gene_family="HOG000023219" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase sigma factor"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340672"
FT                   /db_xref="GeneID:5686454"
FT                   /translation="MNKGTGLRPPPDIIATMARYPDLSPEREAELIIKAQNGDYEARQT
FT                   VIYSNLAWICSRGGQFSRKGIDDGELINEGYWGLNRAIDQWDPTKGANLRTYSERKIYK
FT                   FQSEAIRQKNHIRLPKSTYEQLSKLKKATESLGEDATVAQLAEETEIKEKRIRKLQEIS
FT                   QPVSLNSVTGERENLELLDQQADDSLGSLDPALSSELLDLVDKLHPRQREILHLYHWEE
FT                   LSFQKISDYLGLPAKQVRKLYKKALDLLRKFLQGEINEFPPLPLLEWRNFIFAKFFLAT
FT                   GLSQIFNIVVAKLKRLKRLHRNNHIATVQSQLTVSQSTTEVLPASGPECAIQAPAEPST
FT                   QYSAWYERLWQFVNRDKPTHSRVNTHQIDSGGLRDGPKYLVDTFWHGLNCIAQFLGYWP
FT                   GSPRGSDQYRCRSGDRWRCRGQTEGRYSKKKVIRIVGNPTF"
FT                   /protein_id="YP_001521840.1"
FT   misc_feature    <22592..23317
FT                   /note="DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32) [Transcription]; Region: RpoD; COG0568"
FT                   /db_xref="CDD:30914"
FT                   /locus_tag="AM1_D0029"
FT   misc_feature    23147..23305
FT                   /note="Sigma70, region (SR) 4 refers to the most C-terminal
FT                   of four conserved domains found in Escherichia coli (Ec)
FT                   sigma70, the main housekeeping sigma, and related
FT                   sigma-factors (SFs). A SF is a dissociable subunit of RNA
FT                   polymerase, it directs bacterial...; Region: Sigma70_r4;
FT                   cd06171"
FT                   /db_xref="CDD:100119"
FT                   /locus_tag="AM1_D0029"
FT   misc_feature    order(23174..23176,23204..23206,23222..23227,23255..23257,
FT                   23261..23266,23270..23278,23282..23287,23291..23293)
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:100119"
FT                   /locus_tag="AM1_D0029"
FT   gene            24113..25090
FT                   /db_xref="GeneID:5686455"
FT                   /locus_tag="AM1_D0030"
FT   CDS_pept        24113..25090
FT                   /locus_tag="AM1_D0030"
FT                   /gene_family="HOG000023220" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340673"
FT                   /db_xref="GeneID:5686455"
FT                   /translation="MYKHIPHAIPIALCLAAVPGIAQAQDFPTIEVAPRHGHTFYFKNE
FT                   EAVVVEAWPGAFDAFDFGERPKIPSARFIFVNLKPKGNIDSTTLTVVYRVGTKEKTKTF
FT                   LLKKTKGIPSRFSTAIDGAPPLAAQPQPVQPITVTNVFTPPPKPVKQIHKEKKAKKPRK
FT                   LKVSKEFSSPFSSGFASSNSVAQPPASKETQQPEPEETEETDVPDSVEPKTEEKAETPQ
FT                   SEPLPLIRAPKTLQAKATIETPTEKQLIARSSLDNFGIARYLLRGLYQAERLNQINTHT
FT                   PQFGQAQDTAIWLRRGRSIEEALELSGLPPVTFNNLLGHGGVGK"
FT                   /protein_id="YP_001521841.1"
FT   gene            25087..25998
FT                   /db_xref="GeneID:5686456"
FT                   /locus_tag="AM1_D0031"
FT   CDS_pept        25087..25998
FT                   /locus_tag="AM1_D0031"
FT                   /gene_family="HOG000023221" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase M23 domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340674"
FT                   /db_xref="GeneID:5686456"
FT                   /translation="MIKPLILLSLLGQLNVAPSIGEGNIAPAIGEQPKPVETEPVVTEL
FT                   KPEPAAVQTDVPLETATAPPVPIDIPVPEPLAEESAVLAPPLEQPESTLEDHHQPYGEI
FT                   PSTPLQPPYQSPLPTPAPQPQTSVPPKPRQQIQPSSGVAYRQPTAPVPTTIVETIGYPL
FT                   TSTFAVTSAFGWREHPVQGNTSFHAGIDLGAPHGTPTLTMLSGRVIHADWEGGYGKSVV
FT                   IEHPGTGLKTRYAHLSKIHVQPGQWVDQGWHIGDSGATGLVTGPHAHIEMIMNGQPVDP
FT                   WPYLAQASRQAVLINRLHPWAG"
FT                   /protein_id="YP_001521842.1"
FT   misc_feature    25639..25929
FT                   /note="Peptidase family M23; Region: Peptidase_M23;
FT                   pfam01551"
FT                   /db_xref="CDD:144954"
FT                   /locus_tag="AM1_D0031"
FT   gene            complement(26031..26183)
FT                   /db_xref="GeneID:5686457"
FT                   /locus_tag="AM1_D0032"
FT   CDS_pept        complement(26031..26183)
FT                   /locus_tag="AM1_D0032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340675"
FT                   /db_xref="GeneID:5686457"
FT                   /translation="MLSDALELKQQLVLSRPEDNELNIACDLPLHRCLVALTRRLAEIL
FT                   GCEIA"
FT                   /protein_id="YP_001521843.1"
FT   gene            26210..26329
FT                   /db_xref="GeneID:5686458"
FT                   /locus_tag="AM1_D0033"
FT   CDS_pept        26210..26329
FT                   /locus_tag="AM1_D0033"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340676"
FT                   /db_xref="GeneID:5686458"
FT                   /translation="MESGLFLLASALVMLLFIGNTGVIAFSLWTTRPGVKAEK"
FT                   /protein_id="YP_001521844.1"
FT   gene            26491..26607
FT                   /db_xref="GeneID:5686459"
FT                   /locus_tag="AM1_D0034"
FT   CDS_pept        26491..26607
FT                   /locus_tag="AM1_D0034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340677"
FT                   /db_xref="GeneID:5686459"
FT                   /translation="MFDRLDLLSILLKSGLTLATVYVIYLRSAAVKAKRSSR"
FT                   /protein_id="YP_001521845.1"
FT   gene            26652..27131
FT                   /db_xref="GeneID:5686460"
FT                   /locus_tag="AM1_D0035"
FT   CDS_pept        26652..27131
FT                   /locus_tag="AM1_D0035"
FT                   /gene_family="HOG000023222" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340678"
FT                   /db_xref="GeneID:5686460"
FT                   /translation="MQPIQSASQSQLKRFFHEYKYLLIMIAGLAIACIAEPAAAQCLGW
FT                   LCGPKNAITNNGVINGNNSATVFIEFIFLAIQVLILVGLGGLAVVFFFKMDRDENYVKP
FT                   LVALLVALLLIFGTNFVAGYIVGDGNNAGTSASGNNNGANTTQSQPVRGATTVFN"
FT                   /protein_id="YP_001521846.1"
FT   gene            27144..30236
FT                   /db_xref="GeneID:5686461"
FT                   /locus_tag="AM1_D0036"
FT   CDS_pept        27144..30236
FT                   /locus_tag="AM1_D0036"
FT                   /gene_family="HOG000023223" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340679"
FT                   /db_xref="GeneID:5686461"
FT                   /translation="MSDGDRITYTPVLDKKPSIWMIPQATFIVGGVSGVSLLVLYMMLA
FT                   TIHQAPPWWIPTALWVSICSVYWALLGDTPWKVQGQLHRRMPRENKHSTAVRQPVNTLK
FT                   PKLKTRRVGPKSARRKVKPAEEDVDIAAILIFEIDGLTVGAALLQRNNRLQVVWFFYSN
FT                   GIPSSTTVTQARVIGERIQEGFRDLRNGEPLTMHMGSFSDCSKRVAELNRMGEEAPLEE
FT                   STFLLSWMRKRVKALKRLGRYNPKFLRFYIAHDLGAFGQHKDWFSGLMQTIEDQVQTLT
FT                   GQKSPLKDRLHSMLVEAFEDSFYQNQNFFRTCGIPVTPASADQVWEWIYRQFNDDTVPP
FT                   IPQVITITRDGLKAQQYDRRSISSVLLKHCPDYGKKCVWLPGRKKFAGGVILEGRPNRS
FT                   YDPIEGRLDQLLDASSPILGDKNQKTSNNSLHDLEIVVTFTAEHQKGVLQESQKKTGQS
FT                   NQSLRMVEENKRLDGGALYNTRESLDAEMKLRDGCHTTRVGLMIIAYRDKKRQLDRALE
FT                   NIAALPIFSGGKVVRETGYFDSLFLEALPITMESLLSGDPKKLTERFDRRIRETTAAAV
FT                   GLMPLILDSRPDLHGVEFVSRSGSPLLVDPMGRFPHNHMIVVARTRAGKTVLVMQFASN
FT                   VLVRPNHQVIIIDAGREDGSGSYDEFTTFMDCSHFRAGEDSYNIFQIPDQAQLSAEKFE
FT                   KAFITYQKFILSALVTLTTSADDAARLISYYEDILTNLIAAFLADGSIQEKYQQAYKDG
FT                   FGSEAWQQMPCLTTFVEFMSLSRLPAELQNEDAEKAIQRMRMSLIALMQRQSGQALSRP
FT                   STFRTDKPLVVYALGGVQKNADMVPALLAASASMLAQTFSRKKTYVVAEEATHLWQFPS
FT                   YRTIVTEWFTGKAKSGVWVCWVGQSLKILLQHKEANSVLENVGTTLVGWVKEAALKPLK
FT                   EAGLDPELVQPCIGSDFNPPRDCNNCEYATNWLIETDGKYHVGLNYNDFASLGITMNDL
FT                   EKVILREEIYSQINSDNKYERVAGVASYLEETSIDKQGLKS"
FT                   /protein_id="YP_001521847.1"
FT   misc_feature    <28647..>29096
FT                   /note="type-IV secretion system protein TraC; Region:
FT                   TraC-F-type; TIGR02746"
FT                   /db_xref="CDD:162997"
FT                   /locus_tag="AM1_D0036"
FT   misc_feature    <28923..29888
FT                   /note="Type IV secretory pathway, VirB4 components
FT                   [Intracellular trafficking and secretion]; Region: VirB4;
FT                   COG3451"
FT                   /db_xref="CDD:33254"
FT                   /locus_tag="AM1_D0036"
FT   gene            30233..31255
FT                   /db_xref="GeneID:5686462"
FT                   /locus_tag="AM1_D0037"
FT   CDS_pept        30233..31255
FT                   /locus_tag="AM1_D0037"
FT                   /gene_family="HOG000023224" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340680"
FT                   /db_xref="GeneID:5686462"
FT                   /translation="MRNIITGLTAITLIAASSLPTLAQNAASGESDYWRTTDVDYSVFK
FT                   KDQPINNKGLFEVDKKTGKQTQLSKDFQKGVEIYQQAKPVIDLVGGIFGLGGSLGFLKH
FT                   IDNNLEYGEWLFGKVPREQQAQEQQAQGTEANGAPLGDVYGVDGKVDPTKAREQALSTI
FT                   EANADIKADSPFGVSRTMYKLLVGDLAVTRAARKNLELMFGEAGQQFAKEAREYSANVV
FT                   KTSGQMVDQALEAKSTQDVNKIRAQIAANGQLLDQVQFAEQQQTRFSVDRVNDAVLTQL
FT                   ELKQQEKWDKEQDEASADIGLAQVRQLTFSMLHPSGSESGPSNQAAKVSAQQNPSFIRK
FT                   "
FT                   /protein_id="YP_001521848.1"
FT   gene            31255..32325
FT                   /db_xref="GeneID:5686463"
FT                   /locus_tag="AM1_D0038"
FT   CDS_pept        31255..32325
FT                   /locus_tag="AM1_D0038"
FT                   /gene_family="HOG000023226" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340681"
FT                   /db_xref="GeneID:5686463"
FT                   /translation="MFSLDAILIAGINFDSPQDIINNTKEISAEIDKALSVLWGFLGSK
FT                   LFIEISNVAAIIAALGVGFWAIKWIKEVAKSDEFFYPDKIPQMAFGLMLAVLLGAPTER
FT                   GKLLTDVLISYDRFTTNLSNIVLVAARPNPEKDPVASAQVSQAVRDRAAQDAKKCEKLG
FT                   LLTQARFDCVDEAIERVSTSLEPYKEEWASKLHRELTSALGLLNDRAIGEAAKENIKRD
FT                   FTLFAGDALNKVLIFVMFGLTVAFLVLLRVAKPLISIVFPLYIGLSYVPSSKPPVLWAI
FT                   GMLIDIVLIEIIFKIFLSMIAQLALTLPLQIDTLTLGLLIVFGGIPFSIILGRRLSDGL
FT                   TGAGVSAFPGLSRRFR"
FT                   /protein_id="YP_001521849.1"
FT   gene            32322..33041
FT                   /db_xref="GeneID:5686464"
FT                   /locus_tag="AM1_D0039"
FT   CDS_pept        32322..33041
FT                   /locus_tag="AM1_D0039"
FT                   /gene_family="HOG000023227" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340682"
FT                   /db_xref="GeneID:5686464"
FT                   /translation="MKVNVFDKAVASPRQIRPKAVWLGIILIILATVALSYGLINLRIS
FT                   SVEGRLDQLANRPIVVQFGKNAELVKVEPVTPSENVEEFVQEVLPPMFAWSKKVLPEVH
FT                   PTGIDPGRDTKYGKLPTLIFYYTNALEIRYRNVFRKNIANYKPDKFEQGEATLLRIERL
FT                   VKPRQTEEGWEVDVYADLITLDVDDVAYMSEPFNSTIHIKEILPPKHNASFTPIEEAFV
FT                   AVLKRGLIITRIAKLEA"
FT                   /protein_id="YP_001521850.1"
FT   gene            33045..34484
FT                   /db_xref="GeneID:5686465"
FT                   /locus_tag="AM1_D0040"
FT   CDS_pept        33045..34484
FT                   /locus_tag="AM1_D0040"
FT                   /gene_family="HOG000023228" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340683"
FT                   /db_xref="GeneID:5686465"
FT                   /translation="MSTALNKWQDLTGDVDDPLDEIVEEADDDSDEDYSVVTKHTLATN
FT                   PMIKLCIWGGGILVVLLGIFGIFLGVTANGGNTANNQQQQQQAAVPPNAQTGLSKSDQK
FT                   IVEDLLERETFNRQQKRQQVLNGKKQQGKPKGNQRPASVSPQNTVSAPRVIYRARPIQQ
FT                   RSHASYQQDRNRQFLVQRPVAVQPIEQPIDDPNAGFFTAPVAASSSPARTGKRKLLKLS
FT                   KSDEFKSNKSPIKRFTPPVQVASTAQTIPQPSKQFGNLSGNLQNPYMNQIVATASQAVI
FT                   PVDTAISAQVVNRVSWIPENPGLAKGKVVRLKLQDDLKDGAGDVVASRGTIALGIVTQA
FT                   TEQGLISVNLTKIGSKFVQSGAVEIHQDGDPTMIAKLETKGGNNGFIKTALDIGIGGVQ
FT                   TWASNLNNPTSQTAISNGNQTFLSTNNNNRNNTAAFVEGATGRIGERLRQSVNGPTQTK
FT                   IGVFRFGGKKVQLYFVREVRL"
FT                   /protein_id="YP_001521851.1"
FT   gene            34481..34903
FT                   /db_xref="GeneID:5686466"
FT                   /locus_tag="AM1_D0041"
FT   CDS_pept        34481..34903
FT                   /locus_tag="AM1_D0041"
FT                   /gene_family="HOG000023229" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340684"
FT                   /db_xref="GeneID:5686466"
FT                   /translation="MNQLIVALLFLVSWSTVASAQQVRELNLKGTTNMRPIAVDPSGVI
FT                   VHLNNGDKIQGLSLQPPNQIELYPLDGQLCSGVKQCQGQAPSMLQLTRVKPKNIKGKIS
FT                   NSDGSSMLVIVTNSGAKHVLFVVPTSRAKYQVVNIQ"
FT                   /protein_id="YP_001521852.1"
FT   gene            35368..35823
FT                   /db_xref="GeneID:5686467"
FT                   /locus_tag="AM1_D0042"
FT   CDS_pept        35368..35823
FT                   /locus_tag="AM1_D0042"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340685"
FT                   /db_xref="GeneID:5686467"
FT                   /translation="MTYRYKEDKPENWIDREHELPEDNTLWKQYEIYIDIFKFYLDTTW
FT                   KVVTWFYAITGAILVYYFDHADNNNPYLRYSLVLPALLSIGFFIIFGKGAQKNKKLNEW
FT                   LDYIRSELGIPGRPHTEILLIFLEQSRNLFAAVFLGLTILFVSSFFW"
FT                   /protein_id="YP_001521853.1"
FT   gene            complement(36158..36295)
FT                   /db_xref="GeneID:5686468"
FT                   /locus_tag="AM1_D0043"
FT   CDS_pept        complement(36158..36295)
FT                   /locus_tag="AM1_D0043"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340686"
FT                   /db_xref="GeneID:5686468"
FT                   /translation="MDLTIGVDRCANNAVHCSTQINGIDASNYLHLLNRKSEKELPKTT
FT                   "
FT                   /protein_id="YP_001521854.1"
FT   gene            36397..36825
FT                   /db_xref="GeneID:5686469"
FT                   /locus_tag="AM1_D0044"
FT   CDS_pept        36397..36825
FT                   /locus_tag="AM1_D0044"
FT                   /gene_family="HOG000023230" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340687"
FT                   /db_xref="GeneID:5686469"
FT                   /translation="MTESVTLTATVIANLAFQEFLKTSAGEAAKQFTADALSLMGKLRQ
FT                   KIWDRLRGKHGAAEQALTQAETGDQKAIETVATLLDVEMLDETFAGELRQIAQEINIHI
FT                   SKDNDTQVQNNYGGTNFQNSISGGEVYQGDNITINKTI"
FT                   /protein_id="YP_001521855.1"
FT   gene            36994..39105
FT                   /db_xref="GeneID:5686470"
FT                   /locus_tag="AM1_D0045"
FT   CDS_pept        36994..39105
FT                   /locus_tag="AM1_D0045"
FT                   /gene_family="HOG000013629" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340688"
FT                   /db_xref="GeneID:5686470"
FT                   /translation="MGGIGKTELALQYAIAQLEQEQYPGGICWLRARGQEIATQIVTFA
FT                   QTKLGLTFPDGLDEKGQVDYCWGHWREGDVLVVLDDVTEFDAVEPYLPPSDPKFKVLLT
FT                   TRLNLGSSVQSLSIEELDEESALALLETLVGPDRIQSQLEDAKTLCGWVGNLPLGLELL
FT                   GRFLARKLDWSFEKLIGRLESKKLAAKALITKESGMTAQLGVAAALELSWVDLSEAEQE
FT                   LACLLGVFAVAPIPWHLVEECLSDRDKDDLEDIRDEGLRDKNLLKRVEERTYQLHQIVK
FT                   EFFRIKLQESSGNGESLKQSFCKAMVGIAQGIGNNPTIDVIAGMSASIPHLEELVRQWI
FT                   DILSDDDLTWPYVGIGRFYEGQGNYGLALPLYQECLEQTKKRFDSEHPSVAQSLNNLAL
FT                   LYDNQGRYTEAEPLYVQALEMRQNLLGTEHPDAATSLNNLAVLYYDQGRYTEAEPLYLQ
FT                   ALEMRKKLLGSEHPGVALSLNNLAALYTNQGRYTEAEPLYLQALEMRKKLLGSEHPDVA
FT                   TSLNNLAALYTNQGWYTEAEPLYLQALEMQKKLLGSEHPDVAQSLNNLAALYDNQGRYT
FT                   EAEPLYVQALEMRKKLLGSEHPGVALSLNNLAALYTNQGRYTEAEPLYVQALEMRKKLL
FT                   GSEHPDVAQSLNNLAALYDNQGRYSEAEPLYLQALEIYQKLLGDEHPNTVKVQSNFDDC
FT                   RRRIKESNT"
FT                   /protein_id="YP_001521856.1"
FT   misc_feature    36994..>37317
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_D0045"
FT   misc_feature    <38026..38262
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_D0045"
FT   misc_feature    order(38050..38055,38059..38064,38071..38076,38176..38181,
FT                   38188..38193,38200..38205)
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_D0045"
FT   misc_feature    order(38059..38061,38095..38097,38107..38109,38116..38118,
FT                   38185..38187,38221..38223,38233..38235,38242..38244)
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_D0045"
FT   misc_feature    38167..38514
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_D0045"
FT   misc_feature    order(38167..38172,38176..38181,38188..38193,38302..38307,
FT                   38311..38316,38323..38328,38428..38433,38440..38445,
FT                   38452..38457)
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_D0045"
FT   misc_feature    order(38185..38187,38221..38223,38233..38235,38242..38244,
FT                   38311..38313,38347..38349,38359..38361,38368..38370,
FT                   38437..38439,38473..38475,38485..38487,38494..38496)
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_D0045"
FT   misc_feature    38671..39009
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_D0045"
FT   misc_feature    order(38671..38676,38680..38685,38692..38697,38806..38811,
FT                   38815..38820,38827..38832,38932..38937,38944..38949,
FT                   38956..38961)
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_D0045"
FT   misc_feature    order(38689..38691,38725..38727,38737..38739,38746..38748,
FT                   38815..38817,38851..38853,38863..38865,38872..38874,
FT                   38941..38943,38977..38979,38989..38991,38998..39000)
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_D0045"
FT   gene            complement(39141..39266)
FT                   /db_xref="GeneID:5686471"
FT                   /locus_tag="AM1_D0046"
FT   CDS_pept        complement(39141..39266)
FT                   /locus_tag="AM1_D0046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340689"
FT                   /db_xref="GeneID:5686471"
FT                   /translation="MKAFCTVHRYLHRCTKLVLRLTILLGFNFWQLNKFKNADYT"
FT                   /protein_id="YP_001521857.1"
FT   gene            39569..40525
FT                   /db_xref="GeneID:5686472"
FT                   /locus_tag="AM1_D0047"
FT   CDS_pept        39569..40525
FT                   /locus_tag="AM1_D0047"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340690"
FT                   /db_xref="GeneID:5686472"
FT                   /translation="MTEPITLSAAVIANLAFQEILKSSAGEVTKKFTADAIAKMSELRQ
FT                   KIWARLRGKSQKVDDALKNTEQGDSSALSTIAKNLDVVMDEDAEFASQVQAIAQTINAG
FT                   KILDQSNMTQNLSDNAKGWQTKVEGGVAYIGEIHQQFTGDPILKYEPPTINSIRGFHNG
FT                   MQSLVLEDIGNVPVTITKEKHEGINGECDYTIEFEIFNKSRADLKIKAILVEVLSVEPI
FT                   ESIIDYIPLCGLGEARLYSCRVDGRPGIYRSNLLESTFSGYIFLQSGEQETIQIAINTK
FT                   DEGKYTLRSLLELSSVDGLKTISVGEFNNVRFLKLSR"
FT                   /protein_id="YP_001521858.1"
FT   gene            complement(41076..41192)
FT                   /db_xref="GeneID:5686473"
FT                   /locus_tag="AM1_D0048"
FT   CDS_pept        complement(41076..41192)
FT                   /locus_tag="AM1_D0048"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340691"
FT                   /db_xref="GeneID:5686473"
FT                   /translation="MHKNLLENWITKEFGKPTFFQPQLTLKCHCNVLKKTMA"
FT                   /protein_id="YP_001521859.1"
FT   gene            41393..43999
FT                   /db_xref="GeneID:5686474"
FT                   /locus_tag="AM1_D0049"
FT   CDS_pept        41393..43999
FT                   /locus_tag="AM1_D0049"
FT                   /gene_family="HOG000022983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340692"
FT                   /db_xref="GeneID:5686474"
FT                   /translation="MPRYPRRILSLLPAAALALQSFPAVAQIINQQTLEAANHNTQTQE
FT                   EGTIPGLYYDPSGVVAPTFANSQASETAGSIRLPAGSQAPSFLNGAWPANASSDQVLKI
FT                   GHLKDHPQFKQFTELNINEVLKASGKDPSTVTLSEVPIASTMTVGEYLQINPGAAEQSL
FT                   EDAPAVVQSAFGYYEDEPLLHEPIDQTDIVFIEQKASNPEISDIPAEDLLQGDWGEAFT
FT                   QEEQSQLSKTLSKVNERLRKLPLKQLIPLAQGIVSGDWDTVKKQAKDLAIKEGSKVLIK
FT                   ELMKNPKIAKAIKDLPLGTLPLDKLGLADAPGVGETAIKDIPGSEDKTLNQVPGLKDVP
FT                   LDQIDLALALSFTRLDLLGRIDTTDAAAVVDNIDYVISGGTKDQIPKPAPCKIDGKDTK
FT                   NCRHFELDNVDGGGEPTKLSGQAWIQGPDQMVPGGQGWLRIIANGKEVTGIKPWVAGNV
FT                   KLYLEDMREGSGDEVGSARLSTAWQFGYSDPITGSHYTPHFIRIPTPWRIKEGGIMLLL
FT                   ARSGGIPDAIRNLQPSQQQFCREPTLVASAQTNNATDSNQTTGGADGSSPPHSEQHHIN
FT                   QYLARIAYGESTGGTDIGPHPDTGAYGEYQFIQKSRDTLYTRTGIDAWSESKEERDRAA
FT                   LAWIDIYGQEVGHDIISYIRSGNFEAADYLLGRNQFTSLPGGAEDVKWNDPVALEVYGP
FT                   NGNAPVTPTGASASSGVPFCQPTNGSATFAQGPAPEAGQVNASIYQAARQMYGFDTSSG
FT                   PEGGSQACAWAVDHVLAKAGIEPMRTDNVLNVLDKMKSGRGTRINSGQAQPGDIILSKG
FT                   YDHIGICMTAGCTEVLSNSSSKASFSWRSDGTFDGWYDRSRFLHEAPTEEIWRIQR"
FT                   /protein_id="YP_001521860.1"
FT   misc_feature    42008..>42283
FT                   /note="Domain of unknown function (DUF3559); Region:
FT                   DUF3559; pfam12082"
FT                   /db_xref="CDD:152517"
FT                   /locus_tag="AM1_D0049"
FT   gene            43996..44349
FT                   /db_xref="GeneID:5686475"
FT                   /locus_tag="AM1_D0050"
FT   CDS_pept        43996..44349
FT                   /locus_tag="AM1_D0050"
FT                   /gene_family="HOG000023231" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340693"
FT                   /db_xref="GeneID:5686475"
FT                   /translation="MRKLLFVTALTVLTIFSGIQTALANEEQQIANALIQSLPKPAEVE
FT                   KVVVSGSYALVKWVGGPTGGMATLINTDNGWQVMSQTTRGWPSIEIFAKERGMTIEEAE
FT                   ELLDAYDPSWRQW"
FT                   /protein_id="YP_001521861.1"
FT   gene            44422..46203
FT                   /db_xref="GeneID:5686476"
FT                   /locus_tag="AM1_D0051"
FT   CDS_pept        44422..46203
FT                   /locus_tag="AM1_D0051"
FT                   /gene_family="HOG000023232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340694"
FT                   /db_xref="GeneID:5686476"
FT                   /translation="MSHHTEQPIQPPQQPSPQIDFQVYVLGGLFLVILVLVAITKGEIG
FT                   HKKQKLGDARTAKDNEMRKAQHLAYDALEKRERNKITLWAGEPKGLTIDNENREIFIPR
FT                   DLNSWIFSYLEEHFLTFGSSGCGKTFSLMAPLQRAMIKLGLPLCVFDAKGHEETEDQAC
FT                   PSSEIAGYARLHGYKVKIIAPGDKDSDVFNIFDMMEAKDDRPAYEDKDNAYVISDVLNE
FT                   NMQMNNADSGDQFFPLASKQLMQAMFMWAKMLDPDGDELILAYYLLKRVAQVGAAGIAA
FT                   LDLPPYVQIAFDQFLVSAGSPETAASIAGTALILFGRMITPATTATFCGKSTVDLNVTG
FT                   KTLVIFRLNPKMKAATGPMLATTIQCFLLSNCYTARKQPLAFFLDEFQMIKICEIQKIL
FT                   TVARSNGVSLLFATQGMSFIEETYGEKRAIGIVEGCKTQVLGQLNGNKVAEYYGKQLGK
FT                   SEVVTRSKSKSTGKSSSTSRNDSPHAKDLVSMGELMGLPQGSFYVLSRAIGNKRLARIP
FT                   MRRNFVIPKWETDDAKRGVKEWFKYRKVARKRSKAKSMSNEEMIRYREMSVAILPDPKD
FT                   DDDDDGGDTLAKGISSL"
FT                   /protein_id="YP_001521862.1"
FT   misc_feature    44770..45807
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_D0051"
FT   misc_feature    order(44785..44790,44800..44808)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="AM1_D0051"
FT   misc_feature    order(44788..44790,44800..44808,44866..44868,44872..44877,
FT                   45574..45579)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="AM1_D0051"
FT   misc_feature    45562..45576
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="AM1_D0051"
FT   gene            46246..46668
FT                   /db_xref="GeneID:5686477"
FT                   /locus_tag="AM1_D0052"
FT   CDS_pept        46246..46668
FT                   /locus_tag="AM1_D0052"
FT                   /gene_family="HOG000023233" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340695"
FT                   /db_xref="GeneID:5686477"
FT                   /translation="MTEPTESQLQFTELQLQALQSLGLSTPDLYAQYPNSHHNAIETIE
FT                   QRGTEVLPKDTVINEMQIYYGDVAYVAAVTYRGGKLVGFDPVAYAQPADNECVSYRING
FT                   VWAYIQVAGQTLLDLIGEIELPPMPTEQDLLALVAA"
FT                   /protein_id="YP_001521863.1"
FT   gene            46711..46977
FT                   /db_xref="GeneID:5686478"
FT                   /locus_tag="AM1_D0053"
FT   CDS_pept        46711..46977
FT                   /locus_tag="AM1_D0053"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340696"
FT                   /db_xref="GeneID:5686478"
FT                   /translation="MADVLDNGGNAQEGQQINETLINGTAERLQQLIQLAWAILQKGDQ
FT                   WARGLELGNKQLLPETTTLNDLDAAEKAVQDPKNTAVEVNAVE"
FT                   /protein_id="YP_001521864.1"
FT   gene            47146..48877
FT                   /note="integrase, catalytic region"
FT                   /db_xref="GeneID:5686479"
FT                   /locus_tag="AM1_D0054"
FT                   /pseudo
FT   gene            48672..49421
FT                   /db_xref="GeneID:5686480"
FT                   /locus_tag="AM1_D0056"
FT   CDS_pept        48672..49421
FT                   /locus_tag="AM1_D0056"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="GI:158340697"
FT                   /db_xref="GeneID:5686480"
FT                   /translation="MTTLKQLRLRHFLDEWQSIEHQATQENWSYAQFLLALAQGEASRR
FT                   EQNRISRALTEAQLPYGKSWTNFEFAHVPTLNPAALMEFAQTTHWLESGSNILIFGPSG
FT                   TGKTHVSSALGASIIELGKRVKFVTATTLVQQLQLAKLQLELQSLLSKLDRYDLLIIDD
FT                   LGYVQKSDVETSVLFELIAHRYERKSLLITANQPFSQWDSIFPNSMMTVAAIDRLIHHA
FT                   TIFEMQAESFRKQEAAKHTAKSQKTDS"
FT                   /protein_id="YP_001521865.1"
FT   misc_feature    48681..49373
FT                   /note="DNA replication protein [DNA replication,
FT                   recombination, and repair]; Region: DnaC; COG1484"
FT                   /db_xref="CDD:31673"
FT                   /locus_tag="AM1_D0056"
FT   misc_feature    48810..49346
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_D0056"
FT   gene            49640..51148
FT                   /db_xref="GeneID:5686481"
FT                   /locus_tag="AM1_D0058"
FT   CDS_pept        49640..51148
FT                   /locus_tag="AM1_D0058"
FT                   /gene_family="HOG000023234" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340699"
FT                   /db_xref="GeneID:5686481"
FT                   /translation="MKLEPKSLAYLIDIKQNAIESKDQGEVVRATVADPWDIEPDQVVD
FT                   QALDKLEPLESEAIEVDAVVVEPEQLPSQAQSNERPLVNEFIEKAGENIKQGANDFVAQ
FT                   ANAFLAENIQVEYQPIPQQDGTVALAVDTPSLLTQMQLAGGEYAQAAKEKMQSLAPQQY
FT                   ERVSEAVKNTQERVKSALESVSDTVQGRLKEPSLGQRIGELEHSVGLRLDSMGLGIEDL
FT                   FQKVFDIELDKHGTEFALTREIGEFKVEIEALRSQVGGLEGQISAMQQQQVKSQEMIAA
FT                   LQSPKPQLNNPRLSQWQSNFVSTMKDRFQAVKQYIGEKINQVKAKVSDLVESFKHKMVE
FT                   RFQPIADRLRPVYEQAQDLKQKTGEQINQVKATVGEKVDHAKQFVGEKAMDWQAQALAA
FT                   TATYVLAQQGKQTPQGTTIYEGQHFDFHRNQGNSLLIVDKATQQPVYKNGEFNQNAPKD
FT                   VKDKLVKAAQTTQKGIEQKQAHKQAKEQAQTQKPKPKVAAAARR"
FT                   /protein_id="YP_001521866.1"
FT   gene            complement(51138..55172)
FT                   /db_xref="GeneID:5686483"
FT                   /locus_tag="AM1_D0057"
FT   CDS_pept        complement(51138..55172)
FT                   /locus_tag="AM1_D0057"
FT                   /gene_family="HOG000023235" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Shows homology to DNA helicase but no HMM support"
FT                   /db_xref="GI:158340698"
FT                   /db_xref="GeneID:5686483"
FT                   /translation="MFRPTLINKGNAAIEEYYTEDEALKNSEDEYYAPGKDPVVSPCKW
FT                   YGNGADSLNLKGVINQKVFKKLFYGHHPQTGKRLRKKPTNGQERLGIDLTFGPGKEASI
FT                   LALVGGDRRIIELHEQALQKVFDIFQSRYTQTRVRHGNGQRSLVNTNSLIGAFINHATA
FT                   RPVTIDGKTYSDPALHTHIVVMNATQINGKWQSLSNEAIFKSLSLGSIYRHFIDKGLAE
FT                   LGYTVRPDGTIEGLSPETVWHFKKRTQEVERYLKKYGLEDTQENRQNAVLRTRNKKEDN
FT                   TNIPEKMKGWVEELIINGFTLPKPAKKSTWVHRPELTREYVDSAIAHLQERNAEFCHEL
FT                   IEQWVFDQRPPFTYEELQTEIANHPQLIRTKNDTYTTQYALDREEKTRQLWAAGQHKFT
FT                   PITTGKIEFNKMLNADQRNAVRNTLASSNRLIIWHGLSGVGKTTTLSELQKHIEAINPD
FT                   IQIKGYSPTTKAAGVLAEELGIETTTVSGLITRKLDTSPNQWWIIDEAGMKSAEQGLEV
FT                   LKRAEAVNARVLLVGDINQNSSVNAGSPQRSLMKAGAETYHIKTILRQKRIVQRRAVEL
FT                   VSIGKPLEALKLLNEYGHVTEVADHRTRAAQVAEKYLSLKPKERKQTLIVTGTHRERKA
FT                   ITILIREGLRAEGVIKGEDQALRQLVDKRLTTEQTRHLRYYKTDDYVIPNENFSSRLQK
FT                   GKLYKVVGVDEASGVVRVVSQGGQYSSFDPAKLENKTVFTAQKINVAVGDQLRWTRNNL
FT                   HGNNGDQFKVTAVEGHRIQINHKKWIDTSKPLELDYSITSTTHAAQGQTYYRVIFSGTI
FT                   DPTSSREPFYVAISRQKHELYIFTENYEGMCRQVQCSAAQLNPRELLGLDRELELPEFT
FT                   PTAFWTPQTAMAEPPKSGIAAHHWEELIEGSGIHPDLIELNCHSLKGDSVYEYLLEDKI
FT                   AELGAGQVWVEQQQKLRAKIEHCWDGGFWIGAGVDAQSLDDPILSTWGSFKPDHPRYDS
FT                   SRERFQKYEHPQGRSRGIFLTEVPDWFKEYICKKYDTTSAPGDHFWKIIRDNPQIPIKI
FT                   TEGGKKTLSITSQGHVVIGLPGVNAGYRSKDDEGIKLPERRLNPDLAIFAVPGREITFM
FT                   YDQDTKPSTVANVRRDMVRTGMLLEDKGCTVKFSKWSSLYKGADDLIVGASPEMLELAI
FT                   DAAQPLAVATAKHYEYEYQKLYEFVVRRDGELPRKVMNLEIFIEAYTRGTTEDAYKTIE
FT                   AINPDLNREELMKAALQHQDKKRNAATTVVPILEELAKTKGTKYRHTYQYRVDKWLIAT
FT                   GKRGLTVRDTDTGRILLQTKMGRLTRVSARPGVIKLFKSTVKQAKVKPIQRAQKNRKLS
FT                   A"
FT                   /protein_id="YP_001521867.1"
FT   misc_feature    complement(<52632..55145)
FT                   /note="conjugative transfer relaxase protein TraI; Region:
FT                   TraI_TIGR; TIGR02760"
FT                   /db_xref="CDD:163003"
FT                   /locus_tag="AM1_D0057"
FT   misc_feature    complement(54273..55139)
FT                   /note="TrwC relaxase; Region: TrwC; cl08490"
FT                   /db_xref="CDD:164117"
FT                   /locus_tag="AM1_D0057"
FT   gene            complement(55175..55471)
FT                   /db_xref="GeneID:5686482"
FT                   /locus_tag="AM1_D0059"
FT   CDS_pept        complement(55175..55471)
FT                   /locus_tag="AM1_D0059"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340700"
FT                   /db_xref="GeneID:5686482"
FT                   /translation="MGKQYVTKYKLECKPTFPGQEPVCRPGEPYQVEVPPIETGIPGVT
FT                   IPAGINSPIGLLKWDFVFLMTVCMLIGPIRRLLVKSLLLPLRLGAAIDTQRRY"
FT                   /protein_id="YP_001521868.1"
FT   gene            complement(55608..55736)
FT                   /db_xref="GeneID:5686484"
FT                   /locus_tag="AM1_D0060"
FT   CDS_pept        complement(55608..55736)
FT                   /locus_tag="AM1_D0060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340701"
FT                   /db_xref="GeneID:5686484"
FT                   /translation="MWKYVPKKHPLAHSKKSWKNTPQMHSRSGLQRMKTADRRKKF"
FT                   /protein_id="YP_001521869.1"
FT   gene            complement(55796..55945)
FT                   /db_xref="GeneID:5686485"
FT                   /locus_tag="AM1_D0061"
FT   CDS_pept        complement(55796..55945)
FT                   /locus_tag="AM1_D0061"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340702"
FT                   /db_xref="GeneID:5686485"
FT                   /translation="MQYCTLRKIHCDAPKVSKIFHVTTLPRIKKVEPTAIAFFWQQIAN
FT                   HSQP"
FT                   /protein_id="YP_001521870.1"
FT   gene            55932..56054
FT                   /db_xref="GeneID:5686486"
FT                   /locus_tag="AM1_D0062"
FT   CDS_pept        55932..56054
FT                   /locus_tag="AM1_D0062"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340703"
FT                   /db_xref="GeneID:5686486"
FT                   /translation="MQYCISTLILGHHQPVDFSWLTLMEEPMRDLSINLLTLAS"
FT                   /protein_id="YP_001521871.1"
FT   gene            56192..57049
FT                   /db_xref="GeneID:5686487"
FT                   /locus_tag="AM1_D0063"
FT   CDS_pept        56192..57049
FT                   /locus_tag="AM1_D0063"
FT                   /gene_family="HOG000023237" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340704"
FT                   /db_xref="GeneID:5686487"
FT                   /translation="MSKADLLVPKVLAFVGLALDRVPELSPDRVKLVINFMLPISEWTE
FT                   YADLESDLLSCLLGGFGYNGRHIDFAAVDAKGYMEGAGMATIPPPDITAYVGVCGHKDA
FT                   NFIAVEDGRPLAYPKSKTFEGLGMSSIVNSVMHFTDDVQGAKAVFRFLALMDKPNKQDQ
FT                   ARKELAALIKPHRLEQKLTQTREGFNKNWGEIKQRIDSDRGIKQAQAFYLVGGNAPIYK
FT                   SRFKALFGSAFKPLNGAIKQLSDEFEEINTQWAYRAIDVWMLHLHVTGRTWTPKGVKEY
FT                   VGAK"
FT                   /protein_id="YP_001521872.1"
FT   gene            57033..57401
FT                   /db_xref="GeneID:5686488"
FT                   /locus_tag="AM1_D0064"
FT   CDS_pept        57033..57401
FT                   /locus_tag="AM1_D0064"
FT                   /gene_family="HOG000023238" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340705"
FT                   /db_xref="GeneID:5686488"
FT                   /translation="MSEQSRTNIRIRRQPIVGSREALVMKSARAFYGGKFSEKAGLVLV
FT                   DVFEPLHIAMTTGSEQEVKDAIAHSLDEIRGWHREALNQCQKNGYVSASQVVQATTSAD
FT                   MSPQNCDPDEDEPELEFD"
FT                   /protein_id="YP_001521873.1"
FT   gene            57405..57953
FT                   /db_xref="GeneID:5686489"
FT                   /locus_tag="AM1_D0065"
FT   CDS_pept        57405..57953
FT                   /locus_tag="AM1_D0065"
FT                   /gene_family="HOG000023239" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340706"
FT                   /db_xref="GeneID:5686489"
FT                   /translation="MSNQSFSKTLKTLQISKEDLIELRGICGLGEIEEFSESDIEMLKE
FT                   VVQHKQSGAITYTEAWQQMQAEVVPVEAEPVAEKLDGTDHILERAEKIADEDGERVLRS
FT                   LDGYGDDLQTDVTGAYMNRLNHLFQNARVQKAVVEEPDELAKKPGPFTSRLRERLAAQA
FT                   KQTALPASTTSSTETSPTE"
FT                   /protein_id="YP_001521874.1"
FT   gene            57950..58237
FT                   /db_xref="GeneID:5686490"
FT                   /locus_tag="AM1_D0066"
FT   CDS_pept        57950..58237
FT                   /locus_tag="AM1_D0066"
FT                   /gene_family="HOG000023240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340707"
FT                   /db_xref="GeneID:5686490"
FT                   /translation="MRAIAQEEVFIIQARELKLQGHERTINKINRGLSLMANSSAILVL
FT                   LVVFLAGSGLIVGVNLPKYAICDNQLNPCWWLRFGGSERKVLTNDKAAGL"
FT                   /protein_id="YP_001521875.1"
FT   gene            complement(58465..58602)
FT                   /db_xref="GeneID:5686491"
FT                   /locus_tag="AM1_D0067"
FT   CDS_pept        complement(58465..58602)
FT                   /locus_tag="AM1_D0067"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340708"
FT                   /db_xref="GeneID:5686491"
FT                   /translation="MKLNQYSECSFTEFAVISSVIGVWLNLVKVCENSRHSCAETDSTQ
FT                   "
FT                   /protein_id="YP_001521876.1"
FT   gene            complement(58815..59651)
FT                   /db_xref="GeneID:5686492"
FT                   /locus_tag="AM1_D0068"
FT   CDS_pept        complement(58815..59651)
FT                   /locus_tag="AM1_D0068"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340709"
FT                   /db_xref="GeneID:5686492"
FT                   /translation="MSNPTSFRLPCTLRLKKTLGKSDAIVECTELSIREFIVNSSRATS
FT                   AHQYIQELSAKHSIRVDDSEMPFLRSHISQLYIISVYAQAEEFLEGFRDEHPLSTDWRY
FT                   EKKDDLLKSILKNICQDYQAAKRLVGSLEVELFDHYRMVRNRFVHVDIDVSKIDSKVLH
FT                   LQEEVKAHSSYGKLNAPNKYSDMSFDDFILFTRVVKQLAFKLCQASRPSDRQLADTVFK
FT                   IIQSENSPLSLQKLKQLKCNPDRVKNCLETLLRKLYGLDKLESSPIIRMIQSELLA"
FT                   /protein_id="YP_001521877.1"
FT   gene            60168..60503
FT                   /db_xref="GeneID:5686493"
FT                   /locus_tag="AM1_D0069"
FT   CDS_pept        60168..60503
FT                   /locus_tag="AM1_D0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340710"
FT                   /db_xref="GeneID:5686493"
FT                   /translation="MLLEALEKLLNDLNQSRGQLMNPSQTSNLATEKKPQGMRLRDRLI
FT                   LFGLQEGYYDVSSLTAFYNLNRPSMTAQYGEQIPGERYCYRITELGIIWCQIWRSKPLI
FT                   PIPRTYT"
FT                   /protein_id="YP_001521878.1"
FT   gene            complement(60520..60708)
FT                   /db_xref="GeneID:5686494"
FT                   /locus_tag="AM1_D0070"
FT   CDS_pept        complement(60520..60708)
FT                   /locus_tag="AM1_D0070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340711"
FT                   /db_xref="GeneID:5686494"
FT                   /translation="MESEKWGDFRCEVGIGAKLKNLAPHFRSKIQAIIPKTQPMGPARS
FT                   SKGVIRIRRTIRQPFIR"
FT                   /protein_id="YP_001521879.1"
FT   gene            60731..60904
FT                   /db_xref="GeneID:5686495"
FT                   /locus_tag="AM1_D0071"
FT   CDS_pept        60731..60904
FT                   /locus_tag="AM1_D0071"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340712"
FT                   /db_xref="GeneID:5686495"
FT                   /translation="MTDNPPEPTEVNPSGQTASPTEKRVLEAFAGMMRSCDRIRDTVRT
FT                   TRERVNKETTNL"
FT                   /protein_id="YP_001521880.1"
FT   gene            61042..64683
FT                   /db_xref="GeneID:5686496"
FT                   /locus_tag="AM1_D0072"
FT   CDS_pept        61042..64683
FT                   /locus_tag="AM1_D0072"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340713"
FT                   /db_xref="GeneID:5686496"
FT                   /translation="MTATKDETLTIVPGWSEDNSSDTPDALKAFLDTKPINRSTYISAP
FT                   GYSFDLEVHHWGDRFTITARMGEDAWNIYSSHTFDFSDQESSTDSWYRSDDIQMTPQHY
FT                   EAVTKLIGDIGIEGPTIPTELSGWVSQDRSESRHLNFRFEDKGNRHYLGLDLVRHGDPD
FT                   KIDRLIRDHRFDELVALATGETNAHLNYPHHANLTNLSPRQIEDFILAEAACLAPEYEL
FT                   EPHQMQNILQDMSASVLNSRGYKPDYGYQIAAGNSVEPRTNDFRSSVTCRGEWALEFNW
FT                   EDDYHSMPLGGEPGDTFQSDEDRAAVVTDYGNLGAIEKMIQDSRFRELATASVSAPAHY
FT                   HYYPELNNMQGVYPEVAKERIESHLLLVATEYGLAERGVRLLEDMRLKVMEDRGDHKNH
FT                   SYDGLLGIDRVPQDELQQTLPELDVKASGVELLPNIQEIPQSNQQPNIDLYQSLYGAAD
FT                   QYGDFDVGFTELALGNGYSVTTTDQSLNIFKDDERIIHVVAENPSPYDGFLQEPLQIED
FT                   KTTPGQREELQVELHELKQWAERDFEKNLQETPIAEGAITLEQLANNTQQIKGLADTQV
FT                   TKTPSVPIIKSTQNVFWITHEASYLKSNLTCVKTTRTHTQAKLDAYYIINEGYDHYEIN
FT                   DIEPLPESVCHLLVKFFGYEICEYDDSAIEIDLLYIWQGPRDPDIKVGNKSWYLWLNLS
FT                   RFRWGFYPELMAIMEGRLNVNRLPQYPWNSQHESVTGWDCGDYVIEVAFNLFNSQSEAE
FT                   EFGESCYALALYEEYCNLLKLLYIDPYGDEQRTPIRKDEVKVFLSSSVFDIRSGDLRDR
FT                   DEWELVPIDEWDTPSLVIGAQLYCQGRDAKAIIALEIQELGEKAHDKEEVVTESFNEDQ
FT                   SPECIQEDLENHLTVELIDGEGETQIRQLRMTIRDVVVGVKIGFESYRGGFKSYYEVDL
FT                   SVVESIAKDPRFKELVAISSGMIDYPYVKYPDFSNVQCLDSGDDLKRFVESRAYKLGEE
FT                   YGDSSIAGKLIDEVNHCYALEVDVSRYKIRNDAVKGIPFKPSKFRGGKIDQSGRLPESY
FT                   VSVGKVYTDDQTKNLELPIRIGSEEFTVTVGVETQNGTSYSYGDSLEPVQGITQDQRFN
FT                   ELVAATAGIKEYPYTHNLDFRHPDKLTVEEVQSTINRRAEILGEEYGVRIMGESLVACI
FT                   GTTYAALRGTTREALLQSFVDPSQEIELEANCQCENSRSSDQVLTSS"
FT                   /protein_id="YP_001521881.1"
FT   gene            64732..65160
FT                   /db_xref="GeneID:5686497"
FT                   /locus_tag="AM1_D0073"
FT   CDS_pept        64732..65160
FT                   /locus_tag="AM1_D0073"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340714"
FT                   /db_xref="GeneID:5686497"
FT                   /translation="MSSKRLLEKPITCTRAKTLQQELDKHRQINKEPLAQVSKIVDLED
FT                   EVELLRSQNRELLAARKVTQEKVVNLPIRNQPVHKSDVRKDNFSVQIKTELETLGIKLT
FT                   NTLRKTMEVAHEETVVEAIEALITALETSDIKSPGGLA"
FT                   /protein_id="YP_001521882.1"
FT   gene            65147..65419
FT                   /db_xref="GeneID:5686498"
FT                   /locus_tag="AM1_D0074"
FT   CDS_pept        65147..65419
FT                   /locus_tag="AM1_D0074"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340715"
FT                   /db_xref="GeneID:5686498"
FT                   /translation="MGWLKKAIEGGWSHNERLQKQKKVLYPEGFKKWHEQAVKVNFVLD
FT                   IPIEYLNLDERNEAKVKINKPGIFGAPYRDLHWKEAKIEMLNFHN"
FT                   /protein_id="YP_001521883.1"
FT   gene            65547..67403
FT                   /db_xref="GeneID:5686499"
FT                   /locus_tag="AM1_D0075"
FT   CDS_pept        65547..67403
FT                   /locus_tag="AM1_D0075"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340716"
FT                   /db_xref="GeneID:5686499"
FT                   /translation="MRNNHKKKKFKKQKDNNPLDTKQIDLEIRLDAILKSRCGGAYNIN
FT                   GIRYQILYSILRGLELYNTQCSFSSIRLEGIEDLDCLKINLNNEYIQIKTSKNSWNWAK
FT                   LKEPVKNFLIVLSESPNSLFSIVLNSTFKSDVLKLSKKDKLNSNEYEGIKNKFIKLCSD
FT                   VGASRNEAELLFEKIGIKNLPEKEIYEEIKIGLTNDFQLGSNLVDTYLAVLVSKFLYWA
FT                   QERVTISKKDIELIRVSIGDHIASEEHQAYGRGLIDRISWNIDDKQSDFFEGKGTRPGQ
FT                   ISAGVDVRRIRWLEKIDTAIYKTKICVLKSSSGQGKSALLYRYAYEYWRHEEIYILRVA
FT                   ETDEQAEAVCKYIRFIDSLGLPILLLIDDAGFRARKWPQIVRECVSLGIYVLMSVRHED
FT                   WFRFARRDITNWEVIEPTLDLAEAKQIYSTLKAENYVHSNATSPEWAYEKIGTPKLLIE
FT                   YTYLLTHGRMIEDRLRDQIQQIQDHKEDPAKIEILRRVALADTLGTPVVASRLIKDISL
FT                   SSDPQQLLKSLVDEYIALEETGILRGLHWVRSNHLTSILHEGYPNIVDTLLKTINSVLD
FT                   IDRKRYIAKSLCINDLNLNEFITGLSQLVSNEDLMTFLGVAQ"
FT                   /protein_id="YP_001521884.1"
FT   gene            complement(67413..68102)
FT                   /db_xref="GeneID:5686500"
FT                   /locus_tag="AM1_D0076"
FT   CDS_pept        complement(67413..68102)
FT                   /locus_tag="AM1_D0076"
FT                   /gene_family="HOG000036822" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IS1 transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340717"
FT                   /db_xref="GeneID:5686500"
FT                   /translation="MKCPECGGQHIHKNGHRRGKQNHICVTCGRQFLSTYSKRGYSDWT
FT                   KRLCLRMYVNGMGLKGIERVIGVAHTTVIHWVQQVGVLLPDAYDPDDIPQVGELDELET
FT                   FVGKKRNKVWIWTVVDHFHPGILGWVVGDHSAETFRPLWQAIVCWQCFFWVSDGNPVYP
FT                   GFIPEGDQIVSKTYMTRVEGENTRLRHYLARLHRKTLCYSKSVDMLKHSIRLLIHYLKF
FT                   GEVPIPA"
FT                   /protein_id="YP_001521885.1"
FT   misc_feature    complement(67881..68102)
FT                   /note="Insertion element protein; Region: Ins_element1;
FT                   pfam03811"
FT                   /db_xref="CDD:112615"
FT                   /locus_tag="AM1_D0076"
FT   misc_feature    complement(67452..67811)
FT                   /note="IS1 transposase; Region: Transposase_27; cl00721"
FT                   /db_xref="CDD:120062"
FT                   /locus_tag="AM1_D0076"
FT   gene            68454..70376
FT                   /db_xref="GeneID:5686501"
FT                   /locus_tag="AM1_D0077"
FT   CDS_pept        68454..70376
FT                   /locus_tag="AM1_D0077"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340718"
FT                   /db_xref="GeneID:5686501"
FT                   /translation="MQQIQDKISITGAQNNFAQLGKILDWSALAEVTLLNWHELLSNIS
FT                   STQIIFELSIDEFCIFSQGFYRYDSKKYCDWFNQNYDSIIGYLKLNLDCLSLELFDDEL
FT                   YFEFLVDLNSDDPSGYEETNSRLRRFRSAIPFCKQYQSHGIWLSIKTPLFNDTDKNVNK
FT                   DLLPYSSDGTKVNTWHEVAYSNFIPDSYYDFQKAWNLIRTDAIEFVKYLSKFFRSLLTH
FT                   GSDPKIKNHTSNIEVFITLDKALDNFPSSYDDSSEIISSLLPCSLQTILKKDSYTNKLY
FT                   QSFHTFFYKMRDSLLNPESINNTKDIILNSFLFANYYLPKLHHEFDTLFESCPDYFNIK
FT                   SLNSIEKSAYSTLEDLLQACFSFKIFLINEIEKELQKSREYQVQILTNKTTEVSNFLKD
FT                   IGIDTVLSSDVYNLYDEKHDYINRYFSLAFSVHNPLNYLEVLRSVLEAILKISNIADFF
FT                   CLIPVYKEKLFLPPRNGYHISSLSLLNILGSGEDLNLLELVSITHSLTIQELPESTFSY
FT                   LPELEYEEYLPLTLKGEAVALYTLVISLVKYARAIHRLMATRNDYEVKLYEQHLSKIYA
FT                   FNRNILNKIHELKDKFASYSNQQIIDMNLLSFQQFIYKASENLETPSIDNILSIDISSD
FT                   SIDLS"
FT                   /protein_id="YP_001521886.1"
FT   gene            70505..70705
FT                   /db_xref="GeneID:5686502"
FT                   /locus_tag="AM1_D0078"
FT   CDS_pept        70505..70705
FT                   /locus_tag="AM1_D0078"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340719"
FT                   /db_xref="GeneID:5686502"
FT                   /translation="MNAQAEKLFTEGIIRITNSKLSFREGGNRKHSSRSAADLVVTSMS
FT                   VPDLSLAGELSGEYGLLHSSD"
FT                   /protein_id="YP_001521887.1"
FT   gene            complement(70742..72829)
FT                   /db_xref="GeneID:5686503"
FT                   /locus_tag="AM1_D0079"
FT   CDS_pept        complement(70742..72829)
FT                   /locus_tag="AM1_D0079"
FT                   /gene_family="HOG000022984" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340720"
FT                   /db_xref="GeneID:5686503"
FT                   /translation="MATTAIAIWTGNLDTIIVFAQKYLVRKKPEITEAQRQKVREELIE
FT                   ILLKQVVERLEDSLYNKIRIDIKREEQRQRVGQGNLIPAQEEETEQITVNFIRRTFQRF
FT                   LESTPPKAVSTSKSTQELYKQESIKGRLLILGEPGSGKTNELLALARDLLSQAQQSLDK
FT                   PIPVIFQLSEWKAEQDFADWLAQQLFEKYSVPFVVSKHWMRHHQLLPLLDGLDELRRVD
FT                   VHKFEGYEQTKMKSLIRGFRHQQFWIPSAVRKVFASFQIFFHKNRQIRAVASDEITPEV
FT                   LDQQWIAKQIQCVREINAFLTRFALPLVVCCRRKEYEALEQQGEYLKQLNGAIYLQALE
FT                   DDQIHDYLHKLKLPERKRDSLWEALQSQPELMKLAHSPLFLLILVVAYKGQNISSTEEL
FT                   LDEYIHKQLYDLNLRGAYPKGKAPTPKQTHHYLSWLASKLDFEGSAEFLIEKLQPSWLD
FT                   TSKAYNQYCWMFRLIGGLIGGLIYGLIHKLSSGLSSGLIFGLSSGLIFGLFGGLTHITT
FT                   SEKLSFSWGAFYRSGLGSVLIFGLFGGLSSGLSSGLFGGLSCGLIFGLISGITASQIDA
FT                   RDKTNANQGIKDSISNGLIVWLIFGLISGVVGGLFNELTGGLIVGLTGGLTGGLIFGLN
FT                   AACKHLSLRIALYHSGVAPWNYARFLDHAENQRFIQRTGGRYRFVHDLLRKRFAATLKE
FT                   N"
FT                   /protein_id="YP_001521888.1"
FT   misc_feature    complement(<72224..72631)
FT                   /note="Predicted NTPase (NACHT family) [Signal transduction
FT                   mechanisms]; Region: COG5635"
FT                   /db_xref="CDD:35194"
FT                   /locus_tag="AM1_D0079"
FT   gene            73323..73448
FT                   /db_xref="GeneID:5686504"
FT                   /locus_tag="AM1_D0080"
FT   CDS_pept        73323..73448
FT                   /locus_tag="AM1_D0080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340721"
FT                   /db_xref="GeneID:5686504"
FT                   /translation="MPKIRCFNISNDEMIEYSLNIFFKVINHLICYSKLDSLLQD"
FT                   /protein_id="YP_001521889.1"
FT   gene            73580..73915
FT                   /db_xref="GeneID:5686505"
FT                   /locus_tag="AM1_D0081"
FT   CDS_pept        73580..73915
FT                   /locus_tag="AM1_D0081"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340722"
FT                   /db_xref="GeneID:5686505"
FT                   /translation="MFALIGLGDIVGRFVSFFAKNRSSNLTRKVASFSYLFGCSIVVIF
FT                   YFSNLKSENLSRNIFFKAVNIILSLIPSIILTLRTGRVEPLYTWILIIPRVIGMYAGST
FT                   QAYEQAS"
FT                   /protein_id="YP_001521890.1"
FT   gene            complement(74214..74651)
FT                   /db_xref="GeneID:5686506"
FT                   /locus_tag="AM1_D0082"
FT   CDS_pept        complement(74214..74651)
FT                   /locus_tag="AM1_D0082"
FT                   /gene_family="HOG000023107" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340723"
FT                   /db_xref="GeneID:5686506"
FT                   /translation="MRYTLSALKSAVLAAATASSKPGFEGEFATSAQLRKAVSAKWPDD
FT                   TNDARTRGYWLGLATYFDIDNQPWKDAKATKTKLSDIKTEVLAHYEVSDTNALKAKLKD
FT                   WGISHDKLSTRKAWEELLAGCKASRKGQVIELPADPLGMVA"
FT                   /protein_id="YP_001521891.1"
FT   gene            75002..75757
FT                   /db_xref="GeneID:5686507"
FT                   /locus_tag="AM1_D0083"
FT   CDS_pept        75002..75757
FT                   /locus_tag="AM1_D0083"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340724"
FT                   /db_xref="GeneID:5686507"
FT                   /translation="MPSPTERPNTDYTKRNNIRRIVKIACAPLLYKVLVEKRDLAGELV
FT                   RDAQGKKVLEEIPLQDATSAQLFNHYRHNVTNYEEAIDLIKQSQNGYISDKQVKWCSAA
FT                   SAEVVMAVLRTEHEITLEKYFELESDFQDIIEAAQTNNLFDIIQLIRQSVGNAVESTLQ
FT                   KSLIRANNSRNTYRNENNLQRCKLYLIDDTVNHEDDLSVIRERVNIVLKQRGTNKLAEA
FT                   WAKLTDWESSEVIELFKREGLIRDLKKLE"
FT                   /protein_id="YP_001521892.1"
FT   gene            75762..76088
FT                   /db_xref="GeneID:5686508"
FT                   /locus_tag="AM1_D0084"
FT   CDS_pept        75762..76088
FT                   /locus_tag="AM1_D0084"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340725"
FT                   /db_xref="GeneID:5686508"
FT                   /translation="MKKIKELKSEVFVLLNVTSTIQLKKEYKSIASGKDFRFKKTWIEL
FT                   LESLTKCIDLKASAKVIKQSMHRVGRAVGNSYQQTEEQIATIKERVRLKKIAQGKDRLV
FT                   GGGI"
FT                   /protein_id="YP_001521893.1"
FT   gene            76085..76384
FT                   /db_xref="GeneID:5686509"
FT                   /locus_tag="AM1_D0085"
FT   CDS_pept        76085..76384
FT                   /locus_tag="AM1_D0085"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340726"
FT                   /db_xref="GeneID:5686509"
FT                   /translation="MRFTTAKSLINLDPLPEICGIYFVVTAEDEIIYVGQTTNLKNRWK
FT                   DGHKVLKRMLAEGIDPTKARLEWQKFPKRLLNRVENCAVRVHQPRLNEKSPPVL"
FT                   /protein_id="YP_001521894.1"
FT   misc_feature    76142..76360
FT                   /note="GIY-YIG catalytic domain; Region: GIY-YIG; cl01061"
FT                   /db_xref="CDD:174510"
FT                   /locus_tag="AM1_D0085"
FT   gene            76607..77578
FT                   /db_xref="GeneID:5686510"
FT                   /locus_tag="AM1_D0086"
FT   CDS_pept        76607..77578
FT                   /locus_tag="AM1_D0086"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340727"
FT                   /db_xref="GeneID:5686510"
FT                   /translation="MNNPLIYLLEVANNLNSLAFGYYSQGRYEEASPLYQQALEIYQQL
FT                   DYKHLDVASNLDNLARIKMYQFGNLEETESLYLQALEMRQKLLGTNHLDVIASLSRLAD
FT                   FYFKVTRYEDAEPFYLQALKTSEKLQSNETTDIADFQSALALNYSILERYEEAESFYVQ
FT                   ALEMRQKLLGTEHPDVATSFEDLAGFYKYQGRCEEAETLYMQALEINQNFFGYEHLKVA
FT                   ASLSSLAGFYFYQRRYEKAEYFYVQSLEIQEKLDSEDFCDICDLQNLAQLYYDQGKYEA
FT                   AEHFYAKLLVYFQELNGYEDDSAVTAQRNLDDCRHKIMELNT"
FT                   /protein_id="YP_001521895.1"
FT   misc_feature    <77009..77470
FT                   /note="type IV pilus biogenesis/stability protein PilW;
FT                   Region: type_IV_pilW; TIGR02521"
FT                   /db_xref="CDD:131573"
FT                   /locus_tag="AM1_D0086"
FT   gene            complement(77863..80007)
FT                   /db_xref="GeneID:5686511"
FT                   /locus_tag="AM1_D0087"