(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7

ID   ACAM1_7; SV 1; empty ; DNA; empty ; PRO; 172728 BP.
XX
AC   NC_009931;
XX
PR   Project: 58167;
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB6, complete sequence.
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Acaryochloris.
XX
RN   [1]
RP   1-172728
RX   PUBMED; 18252824.
RA   Swingley,W.D., Chen,M., Cheung,P.C., Conrad,A.L., Dejesa,L.C., Hao,J.,
RA   Honchak,B.M., Karbach,L.E., Kurdoglu,A., Lahiri,S., Mastrian,S.D.,
RA   Miyashita,H., Page,L., Ramakrishna,P., Satoh,S., Sattley,W.M., Shimada,Y.,
RA   Taylor,H.L., Tomo,T., Tsuchiya,T., Wang,Z.T., Raymond,J., Mimuro,M.,
RA   Blankenship,R.E. and Touchman,J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105 (6), 2005-2010 (2008)
XX
RN   [2]
RP   1-172728
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (17-OCT-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-172728
RA   Touchman,J.;
RT   "Direct Submission";
RL   Submitted (25-SEP-2007) Translational Genomics Research Institute, 13208 E
RL   Shea Blvd, Scottsdale, AZ 85004, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000843.
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..172728
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:329726"
FT                   /note="type strain of Acaryochloris marina"
FT                   /strain="MBIC11017"
FT                   /plasmid="pREB6"
FT                   /organism="Acaryochloris marina MBIC11017"
FT   gene            3..311
FT                   /db_xref="GeneID:5686922"
FT                   /locus_tag="AM1_F0001"
FT   CDS_pept        3..311
FT                   /locus_tag="AM1_F0001"
FT                   /gene_family="HOG000288608" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341328"
FT                   /db_xref="GeneID:5686922"
FT                   /translation="MNVVENWNSANDFIFYGKNGDFASNQTAMQELSMLCLHLLQISLV
FT                   YINTLMIQKVLSEPTWMNRMQEEDLRALTPLFYLHINPYGRFRLNMNERLVIENLAA"
FT                   /protein_id="YP_001522307.1"
FT   misc_feature    <3..215
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="AM1_F0001"
FT   gene            629..2290
FT                   /db_xref="GeneID:5686923"
FT                   /locus_tag="AM1_F0002"
FT   CDS_pept        629..2290
FT                   /locus_tag="AM1_F0002"
FT                   /gene_family="HOG000013348" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341141"
FT                   /db_xref="GeneID:5686923"
FT                   /translation="MSMRPTDLLDIPSETIEVARAAFPDGNLYMQLRDELGIIYHDHDF
FT                   ADLFPKKGQPALSPWQLVLVCIMQFLENLSDRQAADAVRARIDWKYALSLPLRDSGFNY
FT                   SVLSEFRKRLIAGDKEQQLFDSFLEHLQAKGFLKEHHQQRTDATHILASIRTLNRLELF
FT                   GETFRAALNSLVVADPQWLSEHMHDDWFDRYGRRIENYRLPKPDSERKALGSTIGQDGL
FT                   TLLDAIYAPSSPPWLKHLPAVETLRQVWLQRFYPPNADGTVEWRKVKDMPPSDSSIHSP
FT                   YDVEARYSNKRSMDWVGYKVHLTEVCDPESPRLITHVHTTSATVPDDQVVEPIHLALAK
FT                   KQLLPKEHLLDGGYLSAEHLVNSKAEYDMDVIGPVRQNHSWQAKAGNGFDSSFFLISWD
FT                   QQKVVCPQGHFSTKWLPGKDIHGKDVIQARFQGTTCRSCPVRSQCTKSKTQPRELTFRP
FT                   RELHQALNERRQVQRTTEFKEKYSLRAGVESTHSQGIRRFGMRQSRYIGLAKSHLQNVF
FT                   CAIALNFVRLDAWFNDVPLAKTRVSLFKRILQPLPA"
FT                   /protein_id="YP_001522308.1"
FT   misc_feature    785..1012
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="AM1_F0002"
FT   gene            complement(2785..3534)
FT                   /db_xref="GeneID:5686924"
FT                   /locus_tag="AM1_F0003"
FT   CDS_pept        complement(2785..3534)
FT                   /locus_tag="AM1_F0003"
FT                   /gene_family="HOG000023285" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341327"
FT                   /db_xref="GeneID:5686924"
FT                   /translation="MVKGVLRHCTQMSVNKSYVDTHGQSEVGFAFCYLLNFQLMPRFKG
FT                   INKQKLYLPMSGQKKKYFHLKAILKRPIRWDLVREQYEPMIQFTTAMKQGTAEPEAILS
FT                   RFTRNNIKHPTYLALAELGRAIKTIFLCQYLHDEALRQEINEGLNVVENWNSANDFIFY
FT                   GKNGDFASNQTAMQELSMLCLHLLQISLXYINTLMIQKVLSEPTWMNRMQEEDLRALTP
FT                   LFYLHINPYGRFRLNMNERLVIENLAA"
FT                   /protein_id="YP_001522309.1"
FT   misc_feature    complement(2881..>3534)
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="AM1_F0003"
FT   gene            complement(3698..5428)
FT                   /db_xref="GeneID:5686925"
FT                   /locus_tag="AM1_F0004"
FT   CDS_pept        complement(3698..5428)
FT                   /locus_tag="AM1_F0004"
FT                   /gene_family="HOG000008626" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-directed DNA polymerase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341326"
FT                   /db_xref="GeneID:5686925"
FT                   /translation="MSKARVKPMMEWSAIPWPKLERKVFKLQKRIFRARQRGDVKVVHR
FT                   LQKTLMRSWSAKCLSVRRVTQDNQGKKTAGVDGVKSLSPEARLPLVGQLKLGSKAPPTR
FT                   RVWIPKPGKDEQRPLGIPTLYERARMTLVKLALEPEWEAVFEPNSYGSRPGRSCHDAIE
FT                   QIFAAIKQKAKYVLDADIAQCFDRINHEALLKKLKTFPTLRRQIKTWLKAGVIDGHQFL
FT                   QTSEGAPQGGTISPLLANVALHGLEYRIKQAFPIRKIADGNKRKRIATPDVIRYCDDFV
FT                   ILHEDLSVVQRCQSLVHEWLKDMGLELKPSKTHISHTLKRYEAENPGFDFLGFSVRQFP
FT                   VGQHQSGRLCGTLLGFKTIITPSRKKQKVHYNRLVSIINAHKAAPQAALIRHLNPVIRG
FT                   WTRYYSTMASKETFSRLDHLLYQKLQTWANHRHPGKSRKWVVNKYWQTVGGDKWVFATR
FT                   VTKSRTEKLLKHRQTPIIRHVKVKGDASPYNGNLVYWSSRTGKHPEAPKRVSMLLKKQK
FT                   GKCAQCGMFFREEDLLEVDHILPTSMGGLDVYKNLQLLHRHCHYVKTAKEKSSQAKWYV
FT                   "
FT                   /protein_id="YP_001522310.1"
FT   misc_feature    complement(4427..5386)
FT                   /note="Retron-type reverse transcriptase [DNA replication,
FT                   recombination, and repair]; Region: COG3344"
FT                   /db_xref="CDD:33153"
FT                   /locus_tag="AM1_F0004"
FT   misc_feature    complement(4421..5119)
FT                   /note="RT_G2_intron: Reverse transcriptases (RTs) with
FT                   group II intron origin. RT transcribes DNA using RNA as
FT                   template. Proteins in this subfamily are found in bacterial
FT                   and mitochondrial group II introns. Their most probable
FT                   ancestor was a retrotransposable...; Region: RT_G2_intron;
FT                   cd01651"
FT                   /db_xref="CDD:73157"
FT                   /locus_tag="AM1_F0004"
FT   misc_feature    complement(order(4430..4435,4592..4597,4601..4603,
FT                   4736..4741,4874..4891))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:73157"
FT                   /locus_tag="AM1_F0004"
FT   misc_feature    complement(order(4595..4597,4739..4741,4874..4891))
FT                   /note="putative NTP binding site; other site"
FT                   /db_xref="CDD:73157"
FT                   /locus_tag="AM1_F0004"
FT   misc_feature    complement(4736..4738)
FT                   /note="putative nucleic acid binding site; other site"
FT                   /db_xref="CDD:73157"
FT                   /locus_tag="AM1_F0004"
FT   misc_feature    complement(4094..4330)
FT                   /note="Group II intron, maturase-specific domain; Region:
FT                   GIIM; pfam08388"
FT                   /db_xref="CDD:149448"
FT                   /locus_tag="AM1_F0004"
FT   misc_feature    complement(3737..3895)
FT                   /note="HNH nucleases; HNH endonuclease signature which is
FT                   found in viral, prokaryotic, and eukaryotic proteins. The
FT                   alignment includes members of the large group of homing
FT                   endonucleases, yeast intron 1 protein, MutS, as well as
FT                   bacterial colicins, pyocins...; Region: HNHc; cd00085"
FT                   /db_xref="CDD:28969"
FT                   /locus_tag="AM1_F0004"
FT   misc_feature    complement(order(3737..3739,3749..3751,3758..3763,
FT                   3773..3778,3809..3811,3815..3823,3827..3829))
FT                   /note="active site"
FT                   /db_xref="CDD:28969"
FT                   /locus_tag="AM1_F0004"
FT   gene            complement(6040..8187)
FT                   /db_xref="GeneID:5686926"
FT                   /locus_tag="AM1_F0005"
FT   CDS_pept        complement(6040..8187)
FT                   /locus_tag="AM1_F0005"
FT                   /gene_family="HOG000081789" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341325"
FT                   /db_xref="GeneID:5686926"
FT                   /translation="MKRKWHPEELLEHWSIQPDEEHLLAKRQGANCLGFVLLLKFFRYE
FT                   GRFPEQKYEIPHMALTFVADQLALLPELFKSYDWHGRNSYYHRAQIRKFTGFRQATVAD
FT                   QNQLRTWLVDTVLSQEQDYHHLKLKVYAQLRTLQIEPPTPARIERLIRSAQRLFENQLF
FT                   SSTLQQLSKQTQTELDELIQEPKVTPGKEIPDPPLSALKKDPGPVGLNSLLSEIIKLQR
FT                   LRQVALPDTLFSHLTPRVLECYRLRVETETLSELRHHPKVIRLTLLASFCWQRCQEIID
FT                   NIMDLLIQIVHRIDTRSKNKVTSEVIAKVKKTDSHTQLFYQVATAALATPDGLVRDVIY
FT                   PVASEQTLEAFVDSYNDGGQTYRQLLHSRIRSSYGHHYRQMLPAVLEVIDFRCNNKQYQ
FT                   PILQAVDLLKAYVDTPRKPYASADDVPIEGVVSADWQETVLGQDEDQPDKVDRIAYEMC
FT                   VLRALREKLRCKEIWVAGANRYRNPDLDLPQDFDERREEYYQDLQQPLEVETFITQIQT
FT                   DMENALTLLNQGMPHNSKVEILSKRGGRIKVSPLEAQPEPMNIQKLKEEINHRWSLTHL
FT                   LDVLKEADFRIDFTQHFKSAASREILSPQSLRKRLLLCIYGLGTNLGIKRIAHSEADAG
FT                   YFELHYVRRKFLSKIALSCAITDVANAIFRIRLSHIWGEATTACASDSRHFESWDQNLM
FT                   TEWHVRYGGRGVMIYWVRFVG"
FT                   /protein_id="YP_001522311.1"
FT   misc_feature    complement(<6061..8166)
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="AM1_F0005"
FT   misc_feature    complement(<6058..6312)
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="AM1_F0005"
FT   gene            8505..10166
FT                   /db_xref="GeneID:5686927"
FT                   /locus_tag="AM1_F0006"
FT   CDS_pept        8505..10166
FT                   /locus_tag="AM1_F0006"
FT                   /gene_family="HOG000013348" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341324"
FT                   /db_xref="GeneID:5686927"
FT                   /translation="MSMRPTDLLDIPSETIEVARAAFPDGNLYMQLRDELGIIYHDHDF
FT                   ADLFPKKGQPALSPWQLVLVCIMQFLENLSDRQAADAVRARIDWKYALSLPLRDSGFNY
FT                   SVLSEFRKRLIAGDKEQQLFDSFLEHLQAKGFLKEHHQQRTDATHILASIRTLNRLELF
FT                   GETFRAALNSLVVADPQWLSEHMHDDWFDRYGRRIENYRLPKPDSERKALGSTIGQDGL
FT                   TLLDAIYAPSSPPWLKHLPAVETLRQVWLQRFYPPNADGTVEWRKVKDMPPSDSSIHSP
FT                   YDVEARYSNKRSMDWVGYKVHLTEVCDPESPRLITHVHTTSATVPDDQVVEPIHLALAK
FT                   KQLLPKEHLLDGGYLSAEHLVNSKAEYDMDVIGPVRQNHSWQAKAGNGFDSSFFLISWD
FT                   QQKVVCPQGHFSTKWLPGKDIHGKDVIQARFQGTTCRSCPVRSQCTKSKTQPRELTFRP
FT                   RELHQALNERRQVQRTTEFKEKYSLRAGVESTHSQGIRRFGMRQSRYIGLAKSHLQNVF
FT                   CAIALNFVRLDAWFNDVPLAKTRVSLFKRILQPLPA"
FT                   /protein_id="YP_001522312.1"
FT   misc_feature    8661..8888
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="AM1_F0006"
FT   gene            10123..10650
FT                   /db_xref="GeneID:5686928"
FT                   /locus_tag="AM1_F0007"
FT   CDS_pept        10123..10650
FT                   /locus_tag="AM1_F0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341323"
FT                   /db_xref="GeneID:5686928"
FT                   /translation="MYLFSRGYFSHYQRDFLEFANSVNPSITPFKKYHVGPQVGESDAA
FT                   VELFSDETREADDRALLLKVRDMVRGAADIAKFTQIVEQMRDATERKIEGNPVTAVEVL
FT                   GDKLNVNQEERSGILTHLIQGGDLTAYGMMNAVTRTSQDVESYDRATELEAMGSQVLSL
FT                   PKATWREIAVAR"
FT                   /protein_id="YP_001522313.1"
FT   gene            complement(10713..10979)
FT                   /db_xref="GeneID:5686929"
FT                   /locus_tag="AM1_F0008"
FT   CDS_pept        complement(10713..10979)
FT                   /locus_tag="AM1_F0008"
FT                   /gene_family="HOG000219995" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="plasmid stability protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341322"
FT                   /db_xref="GeneID:5686929"
FT                   /translation="MSYSVFLAPAAERQLKKLPNKVKAQIVPILKTLTDDPHPSGSAKL
FT                   KGAEDLWKIRKGAYRVIYQIQDKKLTILVVNIAHRRDVYKDKS"
FT                   /protein_id="YP_001522314.1"
FT   misc_feature    complement(10725..10979)
FT                   /note="Plasmid stabilisation system protein; Region:
FT                   Plasmid_stabil; cl11422"
FT                   /db_xref="CDD:164217"
FT                   /locus_tag="AM1_F0008"
FT   gene            complement(10987..11370)
FT                   /db_xref="GeneID:5686930"
FT                   /locus_tag="AM1_F0009"
FT   CDS_pept        complement(10987..11370)
FT                   /locus_tag="AM1_F0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341321"
FT                   /db_xref="GeneID:5686930"
FT                   /translation="MLLIWNTLSSKIVGTKRKINPKSLQNLRPGKSPGRTTLHESTKSR
FT                   HGVSLTDEGWSGVQEAAKKYGYSVSEFLEQIGRGNLAILELEAIEAFQDALDLAEAQTA
FT                   IAEARLVGVRPLEDVLSEIGLED"
FT                   /protein_id="YP_001522315.1"
FT   gene            11631..11813
FT                   /db_xref="GeneID:5686931"
FT                   /locus_tag="AM1_F0010"
FT   CDS_pept        11631..11813
FT                   /locus_tag="AM1_F0010"
FT                   /gene_family="HOG000023174" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341320"
FT                   /db_xref="GeneID:5686931"
FT                   /translation="MSDILTQAWQPRTDAEMSQPWTTPKKWLSVPTQDGYQHQPYDSGD
FT                   SRHFVPDTHPEDTWN"
FT                   /protein_id="YP_001522316.1"
FT   gene            11880..12224
FT                   /db_xref="GeneID:5686932"
FT                   /locus_tag="AM1_F0011"
FT   CDS_pept        11880..12224
FT                   /locus_tag="AM1_F0011"
FT                   /gene_family="HOG000269309" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341319"
FT                   /db_xref="GeneID:5686932"
FT                   /translation="MTITEATQATTIAQLNDRFRQGDHTLGQVYTTQLVQGLSSEEQQE
FT                   LFRLVRTFDDFNLSNDPRGEHNFGRIKFKGEVFNFKIDYYSPDLIHGSEDPEDLTITIR
FT                   VLTLMHSSEY"
FT                   /protein_id="YP_001522317.1"
FT   misc_feature    11967..12218
FT                   /note="Protein of unknown function (DUF3768); Region:
FT                   DUF3768; pfam12599"
FT                   /db_xref="CDD:153033"
FT                   /locus_tag="AM1_F0011"
FT   gene            complement(12473..13576)
FT                   /db_xref="GeneID:5686933"
FT                   /locus_tag="AM1_F0012"
FT   CDS_pept        complement(12473..13576)
FT                   /locus_tag="AM1_F0012"
FT                   /gene_family="HOG000023286" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SCP-like Type I secretion target protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341318"
FT                   /db_xref="GeneID:5686933"
FT                   /translation="MTILEQDRFDQQLLDLVNQERESRGLRPLQLSQNLDQAADQHSAR
FT                   MATGDFFAHRDPQTGTSAGDRIEAAGYTGWSTWGENIAAGQATPEAVLNAWMGSSGHRA
FT                   NILNPNFTHMGIGYDLLENDTGNQRYSHYWTQVFGAGGVTGTYVAQTDGNTTAGNPSNP
FT                   NTPPAPVNPPLTPPVEAPLVGTPGNDQLIGTDSNDNIFGRGGNDILRGQFGNDMLYGEA
FT                   GQDRLYGDAGADQLYGGLDNDTLWGGAGNDSLIGVDTNSPNSASQVDVLVGGQNADMFV
FT                   LGDASAVFYNDGIDNTYGTANYAYIYDFQSVQGDQIQLSGSSGDYRLQSYSSGHLLFLN
FT                   TPGADEVIAFIANTKSLSLTNSVFMFV"
FT                   /protein_id="YP_001522318.1"
FT   misc_feature    complement(13160..13549)
FT                   /note="SCP_bacterial: SCP-like extracellular protein
FT                   domain, as found in bacteria and archaea. The wider family
FT                   of SCP containing proteins includes plant
FT                   pathogenesis-related protein 1 (PR-1), CRISPs, mammalian
FT                   cysteine-rich secretory proteins, and allergen 5...;
FT                   Region: SCP_bacterial; cd05379"
FT                   /db_xref="CDD:88558"
FT                   /locus_tag="AM1_F0012"
FT   misc_feature    complement(12485..>13027)
FT                   /note="RTX toxins and related Ca2+-binding proteins
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]; Region: COG2931"
FT                   /db_xref="CDD:32755"
FT                   /locus_tag="AM1_F0012"
FT   misc_feature    complement(<12809..>12985)
FT                   /note="Peptidase M10 serralysin C terminal; Region:
FT                   Peptidase_M10_C; cl12108"
FT                   /db_xref="CDD:164328"
FT                   /locus_tag="AM1_F0012"
FT   gene            13792..13941
FT                   /db_xref="GeneID:5686934"
FT                   /locus_tag="AM1_F0013"
FT   CDS_pept        13792..13941
FT                   /locus_tag="AM1_F0013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341317"
FT                   /db_xref="GeneID:5686934"
FT                   /translation="MKIQAAKIEVWNGCSFQWIDFQMAQTQNSLGAVQAILDRTKLRFA
FT                   DSKA"
FT                   /protein_id="YP_001522319.1"
FT   gene            14310..14465
FT                   /db_xref="GeneID:5686935"
FT                   /locus_tag="AM1_F0014"
FT   CDS_pept        14310..14465
FT                   /locus_tag="AM1_F0014"
FT                   /gene_family="HOG000022979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341316"
FT                   /db_xref="GeneID:5686935"
FT                   /translation="MKMYIANILVWNGREFMMLPFQQAQTQENLGVVIREYVAAMGLRL
FT                   VYWSKV"
FT                   /protein_id="YP_001522320.1"
FT   gene            14508..14849
FT                   /db_xref="GeneID:5686936"
FT                   /locus_tag="AM1_F0015"
FT   CDS_pept        14508..14849
FT                   /locus_tag="AM1_F0015"
FT                   /gene_family="HOG000022978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341315"
FT                   /db_xref="GeneID:5686936"
FT                   /translation="MDVLILEILSIHLKVGDVLELALIDKKFATEQMIEIPIACKLVKK
FT                   DAIVVHFHHHELDLDFNTVDIHSKNDHRYLTIHSLEIVDPEKGYLVINEEDGAVRYQVA
FT                   WKKISTTYE"
FT                   /protein_id="YP_001522321.1"
FT   gene            14917..15132
FT                   /db_xref="GeneID:5686937"
FT                   /locus_tag="AM1_F0016"
FT   CDS_pept        14917..15132
FT                   /locus_tag="AM1_F0016"
FT                   /gene_family="HOG000022979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341314"
FT                   /db_xref="GeneID:5686937"
FT                   /translation="MQPPGIPHQGAFFMMPRGNPIKMYVAKIEVWNGRSFQLIDFQQAQ
FT                   TQESLRLVIRECVAAMGLKLIYWYES"
FT                   /protein_id="YP_001522322.1"
FT   gene            15154..15678
FT                   /db_xref="GeneID:5686938"
FT                   /locus_tag="AM1_F0017"
FT   CDS_pept        15154..15678
FT                   /locus_tag="AM1_F0017"
FT                   /gene_family="HOG000023287" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HAD superfamily hydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341313"
FT                   /db_xref="GeneID:5686938"
FT                   /translation="MDILSKTMKLIILDKDGTLTTPKSGKNFVQKPEDQILLPGVLDAV
FT                   RWHTLQGHMLIIASNQGGVSAGYKTIAEVILEMKYCLHLLRGIQSAYFCPDFEGNQCWH
FT                   VERQSSSQVEVLRFRGRMRKPGDGMIQQALLDHPCVSEILFIGDRPEDEQAAQAAGVDF
FT                   QDAESWRQPRE"
FT                   /protein_id="YP_001522323.1"
FT   misc_feature    15181..15639
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cd01427"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="AM1_F0017"
FT   misc_feature    order(15193..15201,15328..15333)
FT                   /note="active site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="AM1_F0017"
FT   misc_feature    15193..15210
FT                   /note="motif I; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="AM1_F0017"
FT   misc_feature    15328..15330
FT                   /note="motif II; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="AM1_F0017"
FT   gene            15848..16381
FT                   /db_xref="GeneID:5686939"
FT                   /locus_tag="AM1_F0018"
FT   CDS_pept        15848..16381
FT                   /locus_tag="AM1_F0018"
FT                   /gene_family="HOG000023062" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341312"
FT                   /db_xref="GeneID:5686939"
FT                   /translation="MTVSVPPPTLTSNSQIPSHQTYVRPLGFGESPSGLAIFCNRANTN
FT                   TWYTLSQDSQPVELPYPALTGYLTSIEFIKGEYKRKPTCKLRFRMIAHRPCTLEAGSES
FT                   TFTKGFLSAIASLSPEQLRSPITIEAIPADEETVLFCSVWSGGQKVRTQWDDQTNWREV
FT                   ARRAKDNVAQLQSS"
FT                   /protein_id="YP_001522324.1"
FT   gene            16356..16589
FT                   /db_xref="GeneID:5686940"
FT                   /locus_tag="AM1_F0019"
FT   CDS_pept        16356..16589
FT                   /locus_tag="AM1_F0019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341311"
FT                   /db_xref="GeneID:5686940"
FT                   /translation="MWLNFRVADESNLDWQALKTLTEYCREDIKGFFEDEGFQIYPGRL
FT                   HPYQALFLSNFFVQLVGTRGVLCLLLAGPVSL"
FT                   /protein_id="YP_001522325.1"
FT   gene            17129..17338
FT                   /db_xref="GeneID:5686941"
FT                   /locus_tag="AM1_F0020"
FT   CDS_pept        17129..17338
FT                   /locus_tag="AM1_F0020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341310"
FT                   /db_xref="GeneID:5686941"
FT                   /translation="MAITVINLRYNRNVKGYRCDRASVLGNPFHMFQESERLAVVAAFR
FT                   EYLHEVANLGANPVDVVLLLAEKY"
FT                   /protein_id="YP_001522326.1"
FT   gene            17307..17513
FT                   /db_xref="GeneID:5686942"
FT                   /locus_tag="AM1_F0021"
FT   CDS_pept        17307..17513
FT                   /locus_tag="AM1_F0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341309"
FT                   /db_xref="GeneID:5686942"
FT                   /translation="MWSFFWLKSTNVTVSGMWKHPSRTQVMAELVKLEAMPDMKLLCWC
FT                   VPLACHGDVVKSYLEWKHEEACR"
FT                   /protein_id="YP_001522327.1"
FT   gene            17890..18051
FT                   /db_xref="GeneID:5686943"
FT                   /locus_tag="AM1_F0022"
FT   CDS_pept        17890..18051
FT                   /locus_tag="AM1_F0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341308"
FT                   /db_xref="GeneID:5686943"
FT                   /translation="MIHKSSGRPCCRWLCKDCGKSRGIYPTPKFLMNLREMDEGGETEV
FT                   GLKVLAQV"
FT                   /protein_id="YP_001522328.1"
FT   gene            18048..18533
FT                   /db_xref="GeneID:5686944"
FT                   /locus_tag="AM1_F0023"
FT   CDS_pept        18048..18533
FT                   /locus_tag="AM1_F0023"
FT                   /gene_family="HOG000023169" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341307"
FT                   /db_xref="GeneID:5686944"
FT                   /translation="MIGEKVMAIYSASYFEPHNHHGALVSISRSHPRSFQVDDRLPFLA
FT                   PSRQLLDDWKHRQLTEAGYTDRYRQELQQSWSQVNSWLASVTPEGDCTLLCWEKAGEFC
FT                   HRNLAMKVIRKHRPDCYGGRDISADPGLRCSKCQTVIIPGLDQSFCPCCGEWLATPI"
FT                   /protein_id="YP_001522329.1"
FT   misc_feature    <18168..18365
FT                   /note="Protein of unknown function, DUF488; Region: DUF488;
FT                   cl01246"
FT                   /db_xref="CDD:154288"
FT                   /locus_tag="AM1_F0023"
FT   gene            18973..19092
FT                   /db_xref="GeneID:5686945"
FT                   /locus_tag="AM1_F0025"
FT   CDS_pept        18973..19092
FT                   /locus_tag="AM1_F0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341305"
FT                   /db_xref="GeneID:5686945"
FT                   /translation="MRSLCKLNISQAKLPLKAGANELTELQILFLRQMALNDF"
FT                   /protein_id="YP_001522330.1"
FT   gene            complement(19057..19413)
FT                   /db_xref="GeneID:5686947"
FT                   /locus_tag="AM1_F0024"
FT   CDS_pept        complement(19057..19413)
FT                   /locus_tag="AM1_F0024"
FT                   /gene_family="HOG000034820" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two-component response regulator (CheY)"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341306"
FT                   /db_xref="GeneID:5686947"
FT                   /translation="MKRILLVEDEKRVASFIEKGLLKHGYCPTLVTDGEQALNQIYHES
FT                   YDLVLLDLGLPIISGRAVLQTLRQQGFTLPIIVLTAYSEKKNLALGLGADGFIDKPFRF
FT                   SELLEVIQSHLPQE"
FT                   /protein_id="YP_001522331.1"
FT   misc_feature    complement(19069..19401)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_F0024"
FT   misc_feature    complement(order(19111..19116,19123..19125,19174..19176,
FT                   19234..19236,19258..19260,19387..19392))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_F0024"
FT   misc_feature    complement(19258..19260)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_F0024"
FT   misc_feature    complement(order(19234..19242,19246..19251))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_F0024"
FT   misc_feature    complement(19108..19116)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_F0024"
FT   gene            19557..19718
FT                   /db_xref="GeneID:5686946"
FT                   /locus_tag="AM1_F0026"
FT   CDS_pept        19557..19718
FT                   /locus_tag="AM1_F0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341304"
FT                   /db_xref="GeneID:5686946"
FT                   /translation="MAYEYHRNPDEFLICEGFWVAAPGFIQNKVHRPNYFEQTWQEATG
FT                   KVKQLSLV"
FT                   /protein_id="YP_001522332.1"
FT   gene            20110..20337
FT                   /db_xref="GeneID:5686948"
FT                   /locus_tag="AM1_F0027"
FT   CDS_pept        20110..20337
FT                   /locus_tag="AM1_F0027"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341303"
FT                   /db_xref="GeneID:5686948"
FT                   /translation="MELFNSRAKWMEDYTDHLQTIIVVRSCVKFRTNINGSDSVTCAWF
FT                   VWQKNWSWKKLGVDCPFQIFTKLEELNDGK"
FT                   /protein_id="YP_001522333.1"
FT   gene            20327..21097
FT                   /db_xref="GeneID:5686949"
FT                   /locus_tag="AM1_F0028"
FT   CDS_pept        20327..21097
FT                   /locus_tag="AM1_F0028"
FT                   /gene_family="HOG000151992" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage protein Gp37/Gp68, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341302"
FT                   /db_xref="GeneID:5686949"
FT                   /translation="MENSEIEWTNHTFNPWIGFSHYSPGYVNCYAETQMDKRYDRVKWG
FT                   VVGTRTRTSESYWKLPYKWNRKAAERGGTETVFCGSLADVFEDRDDLIDWRLDLFDTVI
FT                   DKTPNLTWLLLTKRIDMAVLFLTWVRVPPNVWLGHSICTQRESDVVIPKLAKLQHKVGG
FT                   IFLSCEPLLEPLDLGALPVNWVIIGGGSGPSARPCDVAWVRSIRDQCKSVDVPVLIKQL
FT                   GSNPVGVPKLRSAKGGDILEWPKDLRVWEFPEFG"
FT                   /protein_id="YP_001522334.1"
FT   misc_feature    20330..21085
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cl14056"
FT                   /db_xref="CDD:176838"
FT                   /locus_tag="AM1_F0028"
FT   gene            21052..21168
FT                   /db_xref="GeneID:5686950"
FT                   /locus_tag="AM1_F0029"
FT   CDS_pept        21052..21168
FT                   /locus_tag="AM1_F0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341301"
FT                   /db_xref="GeneID:5686950"
FT                   /translation="MAQGSSSVGIPGVWLMEVSVDEERVHSGLASWHHGSSW"
FT                   /protein_id="YP_001522335.1"
FT   gene            21209..21517
FT                   /db_xref="GeneID:5686951"
FT                   /locus_tag="AM1_F0030"
FT   CDS_pept        21209..21517
FT                   /locus_tag="AM1_F0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341300"
FT                   /db_xref="GeneID:5686951"
FT                   /translation="MIRKFKTSNFYQENYIGYMEDGSFDEVLICTYICPGGTSLYQEDV
FT                   WQQNSDINFEIFYLSEPAHAYLYIGCAHWFIPVAFAERLFSVFQTGKANACPGWTAD"
FT                   /protein_id="YP_001522336.1"
FT   gene            complement(22141..22287)
FT                   /db_xref="GeneID:5686952"
FT                   /locus_tag="AM1_F0031"
FT   CDS_pept        complement(22141..22287)
FT                   /locus_tag="AM1_F0031"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341299"
FT                   /db_xref="GeneID:5686952"
FT                   /translation="MTPSAVSRGCADLASGLYPHCERRPEFWLSDKVEQSDLLTMGMGL
FT                   WIG"
FT                   /protein_id="YP_001522337.1"
FT   gene            22291..22761
FT                   /db_xref="GeneID:5686953"
FT                   /locus_tag="AM1_F0033"
FT   CDS_pept        22291..22761
FT                   /locus_tag="AM1_F0033"
FT                   /gene_family="HOG000023058" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341297"
FT                   /db_xref="GeneID:5686953"
FT                   /translation="MPTYDFEQQFEIGTHHEQTLDEYFQQYFWIESTSRQEQRQGIDRW
FT                   FQAPDGSWMSVEYKADKTAGRTGNAFIETISVDVRAVQGWAYSSEADVLAYYVPPRHTV
FT                   WLICFVELRQYLAEWHQRYPIRQIPNHGYCTEGLLVPLVLLSNIAFEVCHVT"
FT                   /protein_id="YP_001522338.1"
FT   gene            complement(22720..22866)
FT                   /db_xref="GeneID:5686955"
FT                   /locus_tag="AM1_F0032"
FT   CDS_pept        complement(22720..22866)
FT                   /locus_tag="AM1_F0032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341298"
FT                   /db_xref="GeneID:5686955"
FT                   /translation="MGVGQRLSCDEYLDAATALLGWKPAYDQPDPQKLVSRHMTNFKRN
FT                   IAQ"
FT                   /protein_id="YP_001522339.1"
FT   gene            23026..23667
FT                   /db_xref="GeneID:5686954"
FT                   /locus_tag="AM1_F0034"
FT   CDS_pept        23026..23667
FT                   /locus_tag="AM1_F0034"
FT                   /gene_family="HOG000276668" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Crp/FNR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341296"
FT                   /db_xref="GeneID:5686954"
FT                   /translation="MAVLPGITTSSSVNGSQVLEKVYQGRQTYEFREGFNIPLHPHDVW
FT                   IVCRGVVQLNTFHGDGNEAILGLVYPDMPFGVPLTQVDPYEAIGLTNVVLMRVSQQEIE
FT                   RSLHLSQWMLVQLQKRLQQTEAFLALNSQRRVGDRLQQLLLLLTKDVGEVIPEGMRLKV
FT                   RFTHQQLAELVGTTRISVTRILGSFRKEGWLSIDGTRHFVIHESSVVDLQ"
FT                   /protein_id="YP_001522340.1"
FT   misc_feature    23116..23643
FT                   /note="cAMP-binding proteins - catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases
FT                   [Signal transduction mechanisms]; Region: Crp; COG0664"
FT                   /db_xref="CDD:31008"
FT                   /locus_tag="AM1_F0034"
FT   misc_feature    23473..23640
FT                   /note="helix_turn_helix, cAMP Regulatory protein
FT                   C-terminus; DNA binding domain of prokaryotic regulatory
FT                   proteins belonging to the catabolite activator protein
FT                   family; Region: HTH_CRP; cd00092"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="AM1_F0034"
FT   misc_feature    order(23515..23517,23521..23529,23554..23556)
FT                   /note="non-specific DNA interactions; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="AM1_F0034"
FT   misc_feature    23554..23574
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="AM1_F0034"
FT   misc_feature    order(23557..23562,23572..23574)
FT                   /note="sequence specific DNA binding site; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="AM1_F0034"
FT   misc_feature    23557..23562
FT                   /note="putative cAMP binding site; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="AM1_F0034"
FT   gene            23986..24666
FT                   /db_xref="GeneID:5686956"
FT                   /locus_tag="AM1_F0035"
FT   CDS_pept        23986..24666
FT                   /locus_tag="AM1_F0035"
FT                   /gene_family="HOG000023057" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341295"
FT                   /db_xref="GeneID:5686956"
FT                   /translation="MKLITSIKLQQADHTEVIDSAATQVGLAANKAFLFVVRKEIQGWK
FT                   NFTALCSWCLSKVSQKHGPIFEEVKERAVAVYRKGCQQETAFVQALIKSQITDRLDAHW
FT                   KLHDQAIDWFKDQTQAFLADSPVEDTSEVEVEDLSPDSSEDLEEIAPVDEGEEPSMTIL
FT                   DEAPVPVLGPPVDPDPLDDELTVPQDPTPVVASGGGKRRTRNKSKRTPLGAMMLSQAKT
FT                   GKPS"
FT                   /protein_id="YP_001522341.1"
FT   gene            24841..25569
FT                   /db_xref="GeneID:5686957"
FT                   /locus_tag="AM1_F0036"
FT   CDS_pept        24841..25569
FT                   /locus_tag="AM1_F0036"
FT                   /gene_family="HOG000023288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CobQ/CobB/MinD/ParA domain-containing protein"
FT                   /transl_table="11"
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   (PF01656)"
FT                   /db_xref="GI:158341294"
FT                   /db_xref="GeneID:5686957"
FT                   /translation="MTVSRIAVAGRKGGVGKTTIACGIASILASMQQRVLVIDMDPQSN
FT                   AAYVLGVDPTKPGTASLLVGDHLEPLKVGDYLWVLPGGPELMNHNIQSCDQEELADAVF
FT                   GMDYDVVVFDCPPGNEHLERLAIKAADTVLIVSDAHPLALVGASRVIKELKLNSQKGRK
FT                   GASRWAIIQSKIDARRAMDRTFDSDLAESFPNLQRFVVRQDTQLSLAAADQIPLMTYDA
FT                   KCRGAQDLIVVAQWGLNGSA"
FT                   /protein_id="YP_001522342.1"
FT   misc_feature    24853..25557
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="AM1_F0036"
FT   misc_feature    24874..>25308
FT                   /note="ArsA ATPase functionas as an efflux pump located on
FT                   the inner membrane of the cell. This ATP-driven oxyanion
FT                   pump catalyzes the extrusion of arsenite, antimonite and
FT                   arsenate. Maintenance of a low intracellular concentration
FT                   of oxyanion produces...; Region: ArsA; cd02035"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="AM1_F0036"
FT   misc_feature    24874..24897
FT                   /note="P loop; other site"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="AM1_F0036"
FT   misc_feature    order(24880..24882,24886..24897,24961..24963,25180..25182)
FT                   /note="Nucleotide binding site; other site"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="AM1_F0036"
FT   misc_feature    order(24961..24969,25180..25203)
FT                   /note="DTAP/Switch II; other site"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="AM1_F0036"
FT   misc_feature    24961..24969
FT                   /note="Switch I; other site"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="AM1_F0036"
FT   gene            25556..26356
FT                   /db_xref="GeneID:5686958"
FT                   /locus_tag="AM1_F0037"
FT   CDS_pept        25556..26356
FT                   /locus_tag="AM1_F0037"
FT                   /gene_family="HOG000023289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341293"
FT                   /db_xref="GeneID:5686958"
FT                   /translation="MAQRKTNTKRFQQALNVADDMSVIDQAISNDTNSNRYLKTAILLD
FT                   QIKLRSEDTRELNQDHVFALSESIEVLGLIEPLVVDTRNRLLAGGHRLSAIHFLRDNKQ
FT                   ERYDEQFPGSKIPVRVMPFDADQDPEKALQCEVAENEHRRDYTATEVRNLAERLKKAGY
FT                   SHGKGRPRKGKKALLPALEVIIGKHTRTIQRYLSDHQKENTTNVALTAETKKLKRIEKD
FT                   LLAWKNENMHCTANSKKALLLKRIPSMAKLINQVLTEIQTQDGN"
FT                   /protein_id="YP_001522343.1"
FT   misc_feature    25685..25975
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="AM1_F0037"
FT   gene            complement(26461..30681)
FT                   /db_xref="GeneID:5686959"
FT                   /locus_tag="AM1_F0038"
FT   CDS_pept        complement(26461..30681)
FT                   /locus_tag="AM1_F0038"
FT                   /gene_family="HOG000023290" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SNF2 family helicase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341292"
FT                   /db_xref="GeneID:5686959"
FT                   /translation="MSLSTNSPEKQEDLSAVRASLVNKYEQLSDLEREIIQAVSVIYTS
FT                   TSRTALLSCLATIGTLSPKQKKLTSSTIRPYIENLLNLEVLLMENTKLRVHPLIIEIAT
FT                   RDAVAKGKFKAMVEAVESIIPFKPGWNGKGLSFDDYQEFIRAFRMGFYQKDFEAIAEYC
FT                   QDYYAYGYRSDKIALDEVLDLVCNNPFDRYWFWTIPMELADLFLVNGLLTDSLMLFSAD
FT                   DKLEVLIEICEDVGGNYLSIVLAEQLILRGRIEEAKACLVDIPADYEHDALAIQGWLAC
FT                   LEGNFDAAIAAYVEALKALRKLTSKRKVYFESISGIFYLLTLLHEGSRASLSSAICYID
FT                   LILESEDHWLSQIYSLLKKVLLIQQGDLSYQNSVINTSVLPYQYGQSLQTLISALCVHW
FT                   VDPSSAKTALVEVLVPYCCQAYNSGYGWLASEAKALIQQLASEQPATKPKLPDLPTPQF
FT                   PLAKLVTAQEDWQLSLKALEQLNSEFLLNDGTGAISRLAWFVSIGSENVTLEPKEQKRN
FT                   AKGGWSKGRKIALSRLFNQPKSLGYLTTQDLKTCAEIEDQVSYYFGYHKTEYQFKEQAI
FT                   AQLVGHPAVFWAGLPSTRIDIIKGEPELLVKEKDQGKLTLELHPPIPRAKDILVTQETP
FT                   TRLKVIEINESHRRIAKILGKYNCLNVPKTAKEQVLSAISSISGLVTVQSDIGGGTENA
FT                   ELVAPHPIPHVHLFPAGDGLKAMIRVRPFRNCGSYFPPGSGGSTVITEIEGRRLQTNRD
FT                   LAEEEQLAQKTIHSCPTLSQYGDDNGEWQITEPEDCLELLYALQSLSDQVIVEWPEGEK
FT                   FRISHRADLDHFKLKISQQQDWFAIQGEVNVDNTLVLDLQKLLALLDETSGRFIKLEEG
FT                   QFLALTQSFRKRLAELQALSEPNGKGLRFHPLASVALEDLVEDIGNLQADKHWRDQKQR
FT                   LNQIKNFEPEIPSTLQVQLRDYQIEGFRWLAKLSHWGVGACLADDMGLGKTLQALAVIL
FT                   TRAPHGPTLIVAPTSVGMNWHKEAKRYAPTLTPLQFDNSNRQQLLEHLKPFDMLICSYG
FT                   LLQQAEVAEMLAQVRWQTIVLDEAQAIKNFSTKRSQAAMKLQGELKIITTGTPIENHLG
FT                   ELWNLFRFINPGLLGSLDSFNQRFAIPIERHQDKAARSCLKKLIQPFILRRTKSQVLEE
FT                   LPSRTEIVLQVDLSPEELAFYEALRQDALAKLNESDAASGPKHIQVLAELMRLRRACCN
FT                   PRLVLPETDLPSAKLQLFAEVLNELLDNKHKALVFSQFVDHLEIIRRYLDEQQIQYQYL
FT                   DGSTPAKNRHKRVDAFQAGEGEIFLISLKAGGTGLNLTAADYVIHMDPWWNPAVEDQAS
FT                   DRAHRIGQQRPVTIYRLVAKGTIEEKIVELHNQKRDLADSLLEGADMSGKVSTDELLRL
FT                   MQQN"
FT                   /protein_id="YP_001522344.1"
FT   misc_feature    complement(26464..28416)
FT                   /note="Superfamily II DNA/RNA helicases, SNF2 family
FT                   [Transcription / DNA replication, recombination, and
FT                   repair]; Region: HepA; COG0553"
FT                   /db_xref="CDD:30899"
FT                   /locus_tag="AM1_F0038"
FT   misc_feature    complement(27379..27768)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="AM1_F0038"
FT   misc_feature    complement(27739..27753)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="AM1_F0038"
FT   misc_feature    complement(27463..27474)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="AM1_F0038"
FT   misc_feature    complement(26608..26976)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="AM1_F0038"
FT   misc_feature    complement(order(26740..26748,26824..26829,26887..26898))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="AM1_F0038"
FT   misc_feature    complement(order(26638..26640,26647..26649,26659..26661,
FT                   26722..26724))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="AM1_F0038"
FT   gene            31038..31532
FT                   /db_xref="GeneID:5686960"
FT                   /locus_tag="AM1_F0039"
FT   CDS_pept        31038..31532
FT                   /locus_tag="AM1_F0039"
FT                   /gene_family="HOG000023291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341291"
FT                   /db_xref="GeneID:5686960"
FT                   /translation="MARKSKGFSELLHQQQDDEQTTAQSFNRLQKKVKKTTGKDLIKDI
FT                   ATSPKGITKMSDVLEEFIDPYKETTSSFEDVESLLSIAVLAWNIALLPDEDRQEAIEII
FT                   LSEAASGMNQKSRAELQTLIHQMIERKDCYFSSFQRYIANFDLQPQGDSYFLSVASSLK
FT                   E"
FT                   /protein_id="YP_001522345.1"
FT   gene            31973..32095
FT                   /db_xref="GeneID:5686961"
FT                   /locus_tag="AM1_F0041"
FT   CDS_pept        31973..32095
FT                   /locus_tag="AM1_F0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341289"
FT                   /db_xref="GeneID:5686961"
FT                   /translation="MGLAIDKAIAEAHRGRVELISEPGVGSTFTISIPFRDSMS"
FT                   /protein_id="YP_001522346.1"
FT   misc_feature    <31973..32080
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="AM1_F0041"
FT   gene            complement(32051..32176)
FT                   /db_xref="GeneID:5686963"
FT                   /locus_tag="AM1_F0040"
FT   CDS_pept        complement(32051..32176)
FT                   /locus_tag="AM1_F0040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341290"
FT                   /db_xref="GeneID:5686963"
FT                   /translation="MIRLLSMGCISFGGEASFQLSFLAIVESTHTVSEGDADSEG"
FT                   /protein_id="YP_001522347.1"
FT   gene            complement(32652..35006)
FT                   /db_xref="GeneID:5686962"
FT                   /locus_tag="AM1_F0042"