(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE1

ACAM1_7.PE1          Location/Qualifiers
FT   CDS_pept        3..311
FT                   /locus_tag="AM1_F0001"
FT                   /gene_family="HOG000288608" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341328"
FT                   /db_xref="GeneID:5686922"
FT                   /translation="MNVVENWNSANDFIFYGKNGDFASNQTAMQELSMLCLHLLQISLV
FT                   YINTLMIQKVLSEPTWMNRMQEEDLRALTPLFYLHINPYGRFRLNMNERLVIENLAA"
FT                   /protein_id="YP_001522307.1"
     TTGAATGTCG TTGAGAATTG GAATAGTGCC AATGACTTCA TCTTCTATGG CAAGAATGGT        60
     GACTTTGCCA GTAATCAAAC GGCTATGCAA GAGCTATCCA TGCTGTGTTT GCACCTACTA       120
     CAAATCAGCC TGGTCTATAT CAATACGCTG ATGATTCAAA AAGTACTTTC TGAGCCGACG       180
     TGGATGAATC GTATGCAAGA AGAAGATTTG AGGGCGTTAA CGCCCCTGTT CTACCTTCAT       240
     ATCAATCCTT ATGGGCGTTT CCGACTAAAC ATGAATGAGC GTCTGGTGAT TGAAAACTTG       300
     GCTGCGTAG                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page