(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE10

ACAM1_7.PE10         Location/Qualifiers
FT   CDS_pept        11631..11813
FT                   /locus_tag="AM1_F0010"
FT                   /gene_family="HOG000023174" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341320"
FT                   /db_xref="GeneID:5686931"
FT                   /translation="MSDILTQAWQPRTDAEMSQPWTTPKKWLSVPTQDGYQHQPYDSGD
FT                   SRHFVPDTHPEDTWN"
FT                   /protein_id="YP_001522316.1"
     ATGTCTGACA TTCTAACCCA AGCTTGGCAA CCCAGAACCG ACGCTGAGAT GAGCCAGCCT        60
     TGGACTACTC CTAAGAAATG GCTCTCAGTC CCGACCCAGG ACGGCTACCA GCATCAACCC       120
     TATGATTCTG GAGATTCTCG TCATTTCGTC CCTGATACCC ACCCAGAAGA CACCTGGAAC       180
     TAA                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page