(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE11

ACAM1_7.PE11         Location/Qualifiers
FT   CDS_pept        11880..12224
FT                   /locus_tag="AM1_F0011"
FT                   /gene_family="HOG000269309" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341319"
FT                   /db_xref="GeneID:5686932"
FT                   /translation="MTITEATQATTIAQLNDRFRQGDHTLGQVYTTQLVQGLSSEEQQE
FT                   LFRLVRTFDDFNLSNDPRGEHNFGRIKFKGEVFNFKIDYYSPDLIHGSEDPEDLTITIR
FT                   VLTLMHSSEY"
FT                   /protein_id="YP_001522317.1"
     ATGACCATTA CAGAAGCAAC CCAAGCCACC ACTATTGCCC AGCTCAATGA CCGCTTTCGT        60
     CAAGGCGACC ATACCCTAGG CCAGGTCTAC ACCACTCAGC TTGTTCAAGG TCTTTCTTCA       120
     GAAGAGCAGC AAGAACTCTT CCGACTGGTC CGCACGTTTG ATGATTTCAA TCTCAGTAAT       180
     GATCCAAGAG GAGAGCATAA TTTTGGGCGC ATCAAATTCA AGGGTGAGGT CTTCAACTTC       240
     AAGATTGATT ACTATTCCCC TGACTTGATT CATGGCTCGG AGGACCCAGA GGATTTAACG       300
     ATTACAATCA GGGTTCTAAC CCTTATGCAC TCCAGCGAAT ACTGA                       345
//

If you have problems or comments...

PBIL Back to PBIL home page