(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE12

ACAM1_7.PE12         Location/Qualifiers
FT   CDS_pept        complement(12473..13576)
FT                   /locus_tag="AM1_F0012"
FT                   /gene_family="HOG000023286" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SCP-like Type I secretion target protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341318"
FT                   /db_xref="GeneID:5686933"
FT                   /translation="MTILEQDRFDQQLLDLVNQERESRGLRPLQLSQNLDQAADQHSAR
FT                   MATGDFFAHRDPQTGTSAGDRIEAAGYTGWSTWGENIAAGQATPEAVLNAWMGSSGHRA
FT                   NILNPNFTHMGIGYDLLENDTGNQRYSHYWTQVFGAGGVTGTYVAQTDGNTTAGNPSNP
FT                   NTPPAPVNPPLTPPVEAPLVGTPGNDQLIGTDSNDNIFGRGGNDILRGQFGNDMLYGEA
FT                   GQDRLYGDAGADQLYGGLDNDTLWGGAGNDSLIGVDTNSPNSASQVDVLVGGQNADMFV
FT                   LGDASAVFYNDGIDNTYGTANYAYIYDFQSVQGDQIQLSGSSGDYRLQSYSSGHLLFLN
FT                   TPGADEVIAFIANTKSLSLTNSVFMFV"
FT                   /protein_id="YP_001522318.1"
     atgacaatcc ttgaacagga tcgctttgat caacaactct tagatcttgt aaaccaggaa        60
     cgcgaatctc gcgggctgag acccctacaa ctcagccaga atcttgatca agctgctgat       120
     cagcattctg ctcgcatggc aacgggtgac ttctttgccc atagagatcc acaaactgga       180
     accagcgctg gagatcgtat tgaagcagca ggatacactg gctggtccac ttggggggag       240
     aacattgctg cagggcaggc aacaccagag gctgttctca atgcctggat gggcagctcc       300
     gggcatcggg ccaatattct aaatcctaat ttcacacaca tgggaattgg gtatgatttg       360
     cttgaaaacg atactggcaa tcagcgttac tcccactact ggactcaagt atttggcgca       420
     gggggtgtca caggcaccta tgttgctcaa accgatggca atactacagc tggtaacccc       480
     tccaatccga acaccccgcc tgccccagtc aatcccccac tgacaccacc cgttgaagca       540
     ccgctagtgg ggacccctgg caacgaccaa ctcatcggta cagacagcaa tgacaacatt       600
     tttggtcgtg gcggaaatga tatcctgcgg ggacaatttg gcaacgacat gctctatgga       660
     gaagctggac aagataggct ctatggggat gctggtgccg atcagctgta tggcggactt       720
     gataatgaca ccctttgggg tggtgccggc aatgattcat tgataggcgt tgatacaaat       780
     tcacccaatt cagcttccca ggtagatgtg cttgtgggtg gacagaatgc agatatgttt       840
     gtcttaggag atgcgtcagc agttttctat aacgatggca tcgacaacac ctatggcaca       900
     gctaattatg cctatatcta tgactttcag agtgtccaag gggatcaaat tcaattgtca       960
     gggagcagtg gagactatcg cctccaatcc tattcatcag gccacctcct atttcttaat      1020
     acgcctggcg ctgatgaagt aattgctttc attgccaata ctaagagcct aagcttgact      1080
     aattcggtat ttatgtttgt gtag                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page