(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE13

ACAM1_7.PE13         Location/Qualifiers
FT   CDS_pept        13792..13941
FT                   /locus_tag="AM1_F0013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341317"
FT                   /db_xref="GeneID:5686934"
FT                   /translation="MKIQAAKIEVWNGCSFQWIDFQMAQTQNSLGAVQAILDRTKLRFA
FT                   DSKA"
FT                   /protein_id="YP_001522319.1"
     ATGAAAATCC AGGCTGCCAA AATCGAAGTC TGGAATGGTT GCTCCTTCCA GTGGATTGAT        60
     TTCCAGATGG CTCAAACCCA GAACAGTCTT GGGGCAGTCC AGGCCATCCT AGATCGGACC       120
     AAGCTAAGGT TTGCTGATTC CAAAGCTTGA                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page