(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE15

ACAM1_7.PE15         Location/Qualifiers
FT   CDS_pept        14508..14849
FT                   /locus_tag="AM1_F0015"
FT                   /gene_family="HOG000022978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341315"
FT                   /db_xref="GeneID:5686936"
FT                   /translation="MDVLILEILSIHLKVGDVLELALIDKKFATEQMIEIPIACKLVKK
FT                   DAIVVHFHHHELDLDFNTVDIHSKNDHRYLTIHSLEIVDPEKGYLVINEEDGAVRYQVA
FT                   WKKISTTYE"
FT                   /protein_id="YP_001522321.1"
     ATGGATGTTT TAATCCTAGA AATACTCTCC ATTCATCTCA AGGTTGGCGA TGTCTTAGAG        60
     TTAGCTTTGA TTGACAAGAA GTTCGCAACG GAGCAAATGA TCGAAATCCC TATTGCTTGC       120
     AAGCTGGTAA AAAAGGATGC AATCGTTGTT CACTTCCACC ACCATGAATT GGACTTAGAC       180
     TTCAATACGG TAGACATACA CTCCAAAAAT GACCATCGGT ATCTGACCAT TCATAGTCTG       240
     GAGATTGTTG ATCCTGAGAA AGGATATCTA GTCATTAATG AAGAGGATGG AGCTGTTCGC       300
     TATCAAGTGG CATGGAAGAA AATATCGACT ACTTACGAAT AG                          342
//

If you have problems or comments...

PBIL Back to PBIL home page