(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE18

ACAM1_7.PE18         Location/Qualifiers
FT   CDS_pept        15848..16381
FT                   /locus_tag="AM1_F0018"
FT                   /gene_family="HOG000023062" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341312"
FT                   /db_xref="GeneID:5686939"
FT                   /translation="MTVSVPPPTLTSNSQIPSHQTYVRPLGFGESPSGLAIFCNRANTN
FT                   TWYTLSQDSQPVELPYPALTGYLTSIEFIKGEYKRKPTCKLRFRMIAHRPCTLEAGSES
FT                   TFTKGFLSAIASLSPEQLRSPITIEAIPADEETVLFCSVWSGGQKVRTQWDDQTNWREV
FT                   ARRAKDNVAQLQSS"
FT                   /protein_id="YP_001522324.1"
     ATGACTGTTT CCGTTCCTCC CCCCACACTT ACCTCAAATT CTCAGATCCC TTCCCATCAG        60
     ACCTATGTGC GTCCCCTTGG ATTTGGTGAG AGTCCTTCTG GCTTAGCTAT ATTCTGCAAC       120
     CGAGCCAATA CGAACACTTG GTATACCCTT AGTCAAGACT CTCAGCCCGT GGAACTCCCC       180
     TATCCTGCGC TCACGGGCTA TCTGACCAGC ATTGAATTTA TCAAAGGGGA GTATAAAAGG       240
     AAGCCCACCT GCAAACTCCG ATTCAGGATG ATTGCCCATC GTCCCTGTAC TCTAGAGGCG       300
     GGTTCCGAGT CCACGTTCAC GAAGGGGTTC TTGAGTGCGA TCGCAAGCTT GTCCCCGGAG       360
     CAACTCCGCA GTCCGATCAC CATCGAAGCG ATTCCTGCTG ATGAAGAAAC TGTGCTTTTT       420
     TGTTCGGTAT GGTCGGGAGG TCAGAAGGTC AGAACCCAAT GGGATGATCA GACCAACTGG       480
     CGAGAGGTCG CTAGACGAGC CAAGGATAAT GTGGCTCAAC TTCAGAGTAG CTGA             534
//

If you have problems or comments...

PBIL Back to PBIL home page