(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE23

ACAM1_7.PE23         Location/Qualifiers
FT   CDS_pept        18048..18533
FT                   /locus_tag="AM1_F0023"
FT                   /gene_family="HOG000023169" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341307"
FT                   /db_xref="GeneID:5686944"
FT                   /translation="MIGEKVMAIYSASYFEPHNHHGALVSISRSHPRSFQVDDRLPFLA
FT                   PSRQLLDDWKHRQLTEAGYTDRYRQELQQSWSQVNSWLASVTPEGDCTLLCWEKAGEFC
FT                   HRNLAMKVIRKHRPDCYGGRDISADPGLRCSKCQTVIIPGLDQSFCPCCGEWLATPI"
FT                   /protein_id="YP_001522329.1"
     TTGATTGGAG AGAAAGTCAT GGCTATCTAT TCCGCATCCT ACTTCGAGCC TCATAACCAT        60
     CACGGAGCGC TGGTATCCAT TTCGAGATCG CACCCCCGAT CCTTCCAGGT CGATGATCGG       120
     TTGCCCTTCC TGGCTCCGTC CCGGCAATTG CTTGACGATT GGAAGCATCG CCAGCTCACC       180
     GAGGCAGGAT ATACCGACCG ATATCGCCAA GAACTACAGC AGTCTTGGTC CCAGGTAAAT       240
     TCTTGGTTAG CCTCAGTAAC CCCAGAGGGA GATTGCACAC TTCTGTGCTG GGAAAAGGCG       300
     GGCGAGTTTT GCCATCGAAA CTTAGCGATG AAGGTTATTC GCAAGCATCG ACCCGATTGC       360
     TACGGTGGCC GCGATATTTC CGCTGATCCG GGCCTGAGAT GTTCGAAATG CCAGACAGTC       420
     ATTATTCCAG GGTTGGATCA AAGTTTTTGC CCGTGCTGTG GCGAGTGGTT AGCTACACCA       480
     ATATAA                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page