(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE26

ACAM1_7.PE26         Location/Qualifiers
FT   CDS_pept        19557..19718
FT                   /locus_tag="AM1_F0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341304"
FT                   /db_xref="GeneID:5686946"
FT                   /translation="MAYEYHRNPDEFLICEGFWVAAPGFIQNKVHRPNYFEQTWQEATG
FT                   KVKQLSLV"
FT                   /protein_id="YP_001522332.1"
     ATGGCTTACG AATATCACAG AAATCCTGAT GAGTTTTTGA TCTGTGAAGG GTTCTGGGTT        60
     GCGGCCCCTG GCTTTATTCA AAACAAAGTA CATCGACCGA ATTACTTTGA ACAGACCTGG       120
     CAAGAGGCGA CCGGGAAGGT TAAGCAGCTC TCGCTAGTTT GA                          162
//

If you have problems or comments...

PBIL Back to PBIL home page