(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE27

ACAM1_7.PE27         Location/Qualifiers
FT   CDS_pept        20110..20337
FT                   /locus_tag="AM1_F0027"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341303"
FT                   /db_xref="GeneID:5686948"
FT                   /translation="MELFNSRAKWMEDYTDHLQTIIVVRSCVKFRTNINGSDSVTCAWF
FT                   VWQKNWSWKKLGVDCPFQIFTKLEELNDGK"
FT                   /protein_id="YP_001522333.1"
     ATGGAACTCT TTAACAGTCG AGCGAAGTGG ATGGAAGACT ATACAGATCA TTTGCAGACA        60
     ATCATCGTGG TCAGATCCTG CGTCAAATTC CGCACTAACA TCAATGGATC TGATTCTGTG       120
     ACCTGTGCCT GGTTTGTGTG GCAAAAGAAT TGGAGCTGGA AAAAGTTAGG CGTAGATTGT       180
     CCATTTCAAA TTTTTACGAA ATTGGAGGAA TTGAACGATG GAAAATAG                    228
//

If you have problems or comments...

PBIL Back to PBIL home page