(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE28

ACAM1_7.PE28         Location/Qualifiers
FT   CDS_pept        20327..21097
FT                   /locus_tag="AM1_F0028"
FT                   /gene_family="HOG000151992" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage protein Gp37/Gp68, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341302"
FT                   /db_xref="GeneID:5686949"
FT                   /translation="MENSEIEWTNHTFNPWIGFSHYSPGYVNCYAETQMDKRYDRVKWG
FT                   VVGTRTRTSESYWKLPYKWNRKAAERGGTETVFCGSLADVFEDRDDLIDWRLDLFDTVI
FT                   DKTPNLTWLLLTKRIDMAVLFLTWVRVPPNVWLGHSICTQRESDVVIPKLAKLQHKVGG
FT                   IFLSCEPLLEPLDLGALPVNWVIIGGGSGPSARPCDVAWVRSIRDQCKSVDVPVLIKQL
FT                   GSNPVGVPKLRSAKGGDILEWPKDLRVWEFPEFG"
FT                   /protein_id="YP_001522334.1"
     ATGGAAAATA GCGAAATTGA GTGGACGAAC CACACGTTCA ATCCCTGGAT CGGCTTTTCA        60
     CACTACAGCC CTGGCTATGT AAATTGTTAT GCTGAGACGC AGATGGATAA GCGGTATGAT       120
     CGCGTGAAGT GGGGGGTTGT GGGCACTAGA ACACGTACCT CAGAATCTTA CTGGAAGCTG       180
     CCCTATAAGT GGAATCGCAA GGCCGCTGAG CGAGGGGGCA CTGAAACGGT ATTCTGTGGT       240
     TCTTTGGCTG ATGTGTTTGA AGATAGAGAT GATCTGATTG ATTGGCGATT GGATCTGTTT       300
     GATACCGTCA TCGATAAAAC CCCGAATCTA ACTTGGCTGC TACTCACCAA ACGGATTGAT       360
     ATGGCTGTCC TTTTCCTGAC TTGGGTGCGA GTCCCTCCTA ATGTTTGGCT GGGTCACAGC       420
     ATCTGCACCC AGCGAGAAAG CGATGTTGTC ATTCCCAAGC TGGCAAAGCT CCAGCATAAA       480
     GTAGGCGGCA TTTTCCTAAG TTGTGAACCC TTGCTTGAAC CCTTGGACCT GGGTGCCCTT       540
     CCCGTGAATT GGGTAATTAT TGGAGGTGGC TCTGGCCCTA GTGCTCGGCC TTGTGATGTG       600
     GCTTGGGTTC GCTCGATTCG AGACCAATGT AAATCAGTAG ATGTCCCTGT GCTTATCAAG       660
     CAGCTCGGCA GCAATCCCGT AGGGGTTCCC AAGCTTCGTT CTGCGAAGGG TGGAGACATT       720
     CTGGAATGGC CCAAGGATCT TCGAGTGTGG GAATTCCCGG AGTTTGGTTG A                771
//

If you have problems or comments...

PBIL Back to PBIL home page