(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE29

ACAM1_7.PE29         Location/Qualifiers
FT   CDS_pept        21052..21168
FT                   /locus_tag="AM1_F0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341301"
FT                   /db_xref="GeneID:5686950"
FT                   /translation="MAQGSSSVGIPGVWLMEVSVDEERVHSGLASWHHGSSW"
FT                   /protein_id="YP_001522335.1"
     ATGGCCCAAG GATCTTCGAG TGTGGGAATT CCCGGAGTTT GGTTGATGGA GGTGTCGGTG        60
     GATGAAGAGA GAGTACATTC AGGGCTGGCG AGTTGGCATC ACGGATCATC CTGGTAG          117
//

If you have problems or comments...

PBIL Back to PBIL home page