(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE30

ACAM1_7.PE30         Location/Qualifiers
FT   CDS_pept        21209..21517
FT                   /locus_tag="AM1_F0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341300"
FT                   /db_xref="GeneID:5686951"
FT                   /translation="MIRKFKTSNFYQENYIGYMEDGSFDEVLICTYICPGGTSLYQEDV
FT                   WQQNSDINFEIFYLSEPAHAYLYIGCAHWFIPVAFAERLFSVFQTGKANACPGWTAD"
FT                   /protein_id="YP_001522336.1"
     GTGATTCGGA AGTTCAAAAC TTCTAACTTT TACCAAGAGA ACTACATCGG CTATATGGAA        60
     GATGGGAGTT TTGATGAAGT CCTGATCTGC ACCTATATCT GTCCAGGAGG AACCAGTCTC       120
     TACCAAGAAG ATGTCTGGCA GCAAAATAGT GATATCAACT TTGAAATCTT CTACCTGAGT       180
     GAACCCGCAC ATGCCTATTT GTATATTGGC TGTGCCCACT GGTTTATTCC AGTGGCGTTT       240
     GCGGAGAGAC TATTCAGCGT ATTCCAGACG GGCAAGGCCA ATGCTTGTCC AGGTTGGACA       300
     GCGGATTAG                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page