(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE31

ACAM1_7.PE31         Location/Qualifiers
FT   CDS_pept        complement(22141..22287)
FT                   /locus_tag="AM1_F0031"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341299"
FT                   /db_xref="GeneID:5686952"
FT                   /translation="MTPSAVSRGCADLASGLYPHCERRPEFWLSDKVEQSDLLTMGMGL
FT                   WIG"
FT                   /protein_id="YP_001522337.1"
     ttgaccccct cagcggtttc aagaggatgc gctgatctgg catcaggtct atatccccat        60
     tgtgaacgaa gacccgaatt ctggctttcg gacaaagtgg agcaatcaga cttgctcacg       120
     atggggatgg ggttatggat tggatga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page