(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE32

ACAM1_7.PE32         Location/Qualifiers
FT   CDS_pept        22291..22761
FT                   /locus_tag="AM1_F0033"
FT                   /gene_family="HOG000023058" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341297"
FT                   /db_xref="GeneID:5686953"
FT                   /translation="MPTYDFEQQFEIGTHHEQTLDEYFQQYFWIESTSRQEQRQGIDRW
FT                   FQAPDGSWMSVEYKADKTAGRTGNAFIETISVDVRAVQGWAYSSEADVLAYYVPPRHTV
FT                   WLICFVELRQYLAEWHQRYPIRQIPNHGYCTEGLLVPLVLLSNIAFEVCHVT"
FT                   /protein_id="YP_001522338.1"
     ATGCCAACCT ATGATTTTGA GCAGCAGTTT GAGATCGGGA CTCATCATGA ACAAACCCTC        60
     GATGAGTATT TTCAGCAGTA CTTCTGGATT GAATCCACAT CTCGTCAGGA GCAGCGACAG       120
     GGGATAGACC GCTGGTTTCA AGCACCCGAT GGGTCATGGA TGTCGGTCGA GTATAAAGCG       180
     GATAAGACAG CGGGCAGGAC GGGCAATGCA TTCATCGAAA CGATCAGCGT AGATGTCAGA       240
     GCGGTTCAGG GCTGGGCCTA TTCGTCCGAG GCCGATGTGT TGGCCTATTA TGTTCCCCCT       300
     CGCCATACCG TTTGGCTGAT CTGCTTTGTA GAGTTGAGGC AATATCTAGC TGAGTGGCAC       360
     CAGCGTTATC CTATCCGTCA GATACCCAAT CACGGTTATT GCACTGAGGG TCTTCTAGTC       420
     CCCCTGGTCT TATTGAGCAA TATTGCGTTT GAAGTTTGTC ATGTGACGTG A                471
//

If you have problems or comments...

PBIL Back to PBIL home page