(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE33

ACAM1_7.PE33         Location/Qualifiers
FT   CDS_pept        complement(22720..22866)
FT                   /locus_tag="AM1_F0032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341298"
FT                   /db_xref="GeneID:5686955"
FT                   /translation="MGVGQRLSCDEYLDAATALLGWKPAYDQPDPQKLVSRHMTNFKRN
FT                   IAQ"
FT                   /protein_id="YP_001522339.1"
     atgggggttg ggcaacgact aagttgtgat gaatacttgg atgcagcgac tgcccttcta        60
     ggctggaagc ccgcttacga ccaaccagat ccccaaaaac tcgtttcacg tcacatgaca       120
     aacttcaaac gcaatattgc tcaataa                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page