(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE35

ACAM1_7.PE35         Location/Qualifiers
FT   CDS_pept        23986..24666
FT                   /locus_tag="AM1_F0035"
FT                   /gene_family="HOG000023057" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341295"
FT                   /db_xref="GeneID:5686956"
FT                   /translation="MKLITSIKLQQADHTEVIDSAATQVGLAANKAFLFVVRKEIQGWK
FT                   NFTALCSWCLSKVSQKHGPIFEEVKERAVAVYRKGCQQETAFVQALIKSQITDRLDAHW
FT                   KLHDQAIDWFKDQTQAFLADSPVEDTSEVEVEDLSPDSSEDLEEIAPVDEGEEPSMTIL
FT                   DEAPVPVLGPPVDPDPLDDELTVPQDPTPVVASGGGKRRTRNKSKRTPLGAMMLSQAKT
FT                   GKPS"
FT                   /protein_id="YP_001522341.1"
     ATGAAATTGA TTACTTCTAT CAAACTCCAG CAAGCCGATC ACACCGAGGT CATCGACAGT        60
     GCTGCTACCC AAGTGGGCCT AGCTGCAAAC AAAGCCTTCC TGTTCGTCGT CCGCAAGGAA       120
     ATCCAAGGCT GGAAAAACTT CACTGCCCTC TGCTCCTGGT GCCTGTCCAA AGTGAGCCAG       180
     AAGCATGGAC CCATCTTTGA GGAGGTCAAA GAGCGTGCTG TAGCTGTCTA CCGCAAGGGC       240
     TGTCAGCAAG AGACAGCCTT TGTCCAAGCG CTTATCAAGT CCCAGATCAC GGATCGGCTT       300
     GATGCTCACT GGAAGCTTCA CGATCAGGCT ATCGATTGGT TCAAGGACCA GACCCAGGCA       360
     TTCCTGGCCG ACAGCCCGGT CGAGGATACT TCTGAGGTCG AGGTTGAGGA TCTATCTCCT       420
     GACAGTTCGG AAGACCTGGA GGAGATTGCA CCTGTGGATG AGGGTGAGGA GCCTTCTATG       480
     ACTATCTTGG ATGAGGCTCC GGTCCCGGTC CTTGGTCCGC CTGTTGATCC TGACCCACTG       540
     GATGATGAGT TGACCGTTCC TCAAGACCCG ACTCCTGTTG TGGCTAGTGG TGGAGGAAAG       600
     CGTCGGACTA GGAACAAGTC CAAGAGAACA CCGCTTGGTG CCATGATGCT TAGCCAAGCC       660
     AAAACAGGAA AACCTAGTTA G                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page