(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE36

ACAM1_7.PE36         Location/Qualifiers
FT   CDS_pept        24841..25569
FT                   /locus_tag="AM1_F0036"
FT                   /gene_family="HOG000023288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CobQ/CobB/MinD/ParA domain-containing protein"
FT                   /transl_table="11"
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   (PF01656)"
FT                   /db_xref="GI:158341294"
FT                   /db_xref="GeneID:5686957"
FT                   /translation="MTVSRIAVAGRKGGVGKTTIACGIASILASMQQRVLVIDMDPQSN
FT                   AAYVLGVDPTKPGTASLLVGDHLEPLKVGDYLWVLPGGPELMNHNIQSCDQEELADAVF
FT                   GMDYDVVVFDCPPGNEHLERLAIKAADTVLIVSDAHPLALVGASRVIKELKLNSQKGRK
FT                   GASRWAIIQSKIDARRAMDRTFDSDLAESFPNLQRFVVRQDTQLSLAAADQIPLMTYDA
FT                   KCRGAQDLIVVAQWGLNGSA"
FT                   /protein_id="YP_001522342.1"
     ATGACTGTTA GTCGAATTGC TGTTGCTGGT CGTAAAGGAG GTGTAGGAAA AACAACAATT        60
     GCCTGTGGAA TTGCATCGAT TCTAGCTAGT ATGCAGCAAA GAGTACTAGT TATTGATATG       120
     GATCCCCAAT CGAATGCTGC TTATGTGCTT GGAGTTGATC CAACAAAGCC TGGAACCGCG       180
     TCTCTGCTGG TTGGTGATCA TCTAGAACCC TTGAAAGTGG GTGATTACCT ATGGGTATTA       240
     CCAGGTGGCC CTGAACTCAT GAATCATAAT ATTCAATCCT GTGATCAAGA AGAGCTTGCT       300
     GATGCAGTTT TTGGTATGGA TTATGATGTC GTTGTTTTTG ACTGCCCTCC TGGGAATGAA       360
     CATTTAGAAA GACTTGCAAT AAAAGCTGCT GATACGGTGC TCATAGTTTC TGATGCACAT       420
     CCACTTGCAT TAGTTGGAGC GAGTCGTGTA ATTAAAGAAT TGAAGCTAAA TAGTCAAAAA       480
     GGTAGAAAAG GAGCTTCAAG GTGGGCGATT ATTCAATCAA AAATTGATGC ACGTCGAGCC       540
     ATGGATCGTA CTTTTGATTC TGATCTGGCA GAGTCATTTC CAAATTTACA ACGGTTTGTT       600
     GTTCGCCAAG ACACACAGTT ATCCCTTGCT GCTGCAGACC AAATCCCACT CATGACTTAC       660
     GATGCTAAGT GCCGTGGAGC CCAAGATTTG ATAGTTGTTG CACAGTGGGG ACTCAATGGC       720
     TCAGCGTAA                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page