(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE37

ACAM1_7.PE37         Location/Qualifiers
FT   CDS_pept        25556..26356
FT                   /locus_tag="AM1_F0037"
FT                   /gene_family="HOG000023289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341293"
FT                   /db_xref="GeneID:5686958"
FT                   /translation="MAQRKTNTKRFQQALNVADDMSVIDQAISNDTNSNRYLKTAILLD
FT                   QIKLRSEDTRELNQDHVFALSESIEVLGLIEPLVVDTRNRLLAGGHRLSAIHFLRDNKQ
FT                   ERYDEQFPGSKIPVRVMPFDADQDPEKALQCEVAENEHRRDYTATEVRNLAERLKKAGY
FT                   SHGKGRPRKGKKALLPALEVIIGKHTRTIQRYLSDHQKENTTNVALTAETKKLKRIEKD
FT                   LLAWKNENMHCTANSKKALLLKRIPSMAKLINQVLTEIQTQDGN"
FT                   /protein_id="YP_001522343.1"
     ATGGCTCAGC GTAAAACCAA TACAAAGCGT TTTCAACAAG CTTTAAATGT AGCTGATGAT        60
     ATGTCAGTGA TTGACCAAGC TATATCTAAT GATACTAATT CAAATCGATA CTTAAAGACG       120
     GCTATCTTAT TAGATCAAAT AAAGCTACGC AGTGAAGACA CTAGGGAACT AAATCAAGAT       180
     CATGTATTTG CTTTATCAGA GTCGATTGAG GTATTGGGAT TAATTGAACC ATTAGTGGTT       240
     GATACTAGGA ATCGGCTATT GGCTGGAGGT CATCGCCTAT CAGCAATACA TTTCCTCCGT       300
     GACAATAAGC AGGAACGATA TGATGAGCAA TTTCCTGGTT CTAAGATACC TGTTCGAGTA       360
     ATGCCTTTTG ATGCGGATCA AGATCCTGAA AAAGCTTTGC AATGTGAAGT AGCGGAAAAT       420
     GAACACAGAC GCGATTATAC AGCTACAGAG GTTAGGAATT TAGCCGAAAG GCTTAAAAAA       480
     GCTGGATACA GTCACGGCAA GGGACGGCCA AGAAAGGGAA AGAAAGCCTT GCTACCTGCA       540
     CTAGAGGTGA TTATTGGTAA GCATACTAGA ACAATTCAAC GCTATCTTAG TGACCATCAA       600
     AAAGAAAATA CGACAAATGT CGCATTAACT GCTGAAACCA AGAAACTGAA AAGGATTGAG       660
     AAAGATCTTC TGGCTTGGAA AAATGAAAAT ATGCACTGCA CTGCTAATTC CAAGAAGGCT       720
     TTGCTGCTTA AACGAATTCC ATCAATGGCA AAACTAATCA ACCAAGTTCT TACGGAAATT       780
     CAAACTCAAG ATGGGAATTA A                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page