(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE39

ACAM1_7.PE39         Location/Qualifiers
FT   CDS_pept        31038..31532
FT                   /locus_tag="AM1_F0039"
FT                   /gene_family="HOG000023291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341291"
FT                   /db_xref="GeneID:5686960"
FT                   /translation="MARKSKGFSELLHQQQDDEQTTAQSFNRLQKKVKKTTGKDLIKDI
FT                   ATSPKGITKMSDVLEEFIDPYKETTSSFEDVESLLSIAVLAWNIALLPDEDRQEAIEII
FT                   LSEAASGMNQKSRAELQTLIHQMIERKDCYFSSFQRYIANFDLQPQGDSYFLSVASSLK
FT                   E"
FT                   /protein_id="YP_001522345.1"
     ATGGCTAGGA AATCTAAAGG TTTTAGTGAA TTACTCCATC AACAACAAGA TGATGAGCAA        60
     ACAACCGCTC AATCCTTCAA TCGGTTGCAA AAAAAAGTTA AGAAAACAAC TGGAAAAGAC       120
     CTTATTAAGG ACATAGCCAC TAGCCCAAAG GGCATTACCA AAATGTCTGA CGTTTTGGAG       180
     GAATTTATTG ATCCCTACAA AGAAACAACT TCTAGTTTTG AAGATGTGGA ATCCTTGCTG       240
     AGTATTGCTG TTCTTGCCTG GAATATCGCC TTATTACCCG ATGAGGACCG CCAAGAAGCT       300
     ATAGAAATTA TTTTGTCAGA AGCTGCCTCT GGGATGAACC AAAAGAGTCG AGCGGAGTTG       360
     CAAACCTTAA TCCATCAGAT GATTGAGCGC AAAGACTGTT ATTTTTCAAG TTTTCAGCGC       420
     TATATTGCTA ATTTTGACTT GCAGCCTCAA GGAGATAGTT ATTTCCTTTC CGTTGCTTCT       480
     TCTCTCAAAG AATAG                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page