(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE40

ACAM1_7.PE40         Location/Qualifiers
FT   CDS_pept        31973..32095
FT                   /locus_tag="AM1_F0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341289"
FT                   /db_xref="GeneID:5686961"
FT                   /translation="MGLAIDKAIAEAHRGRVELISEPGVGSTFTISIPFRDSMS"
FT                   /protein_id="YP_001522346.1"
     ATGGGCTTAG CGATTGATAA AGCCATTGCT GAAGCCCATC GAGGTCGAGT CGAGCTAATA        60
     AGTGAGCCTG GGGTGGGTTC AACCTTCACT ATCAGCATCC CCTTCAGAGA CAGTATGAGT       120
     TGA                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page