(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE7

ACAM1_7.PE7          Location/Qualifiers
FT   CDS_pept        10123..10650
FT                   /locus_tag="AM1_F0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341323"
FT                   /db_xref="GeneID:5686928"
FT                   /translation="MYLFSRGYFSHYQRDFLEFANSVNPSITPFKKYHVGPQVGESDAA
FT                   VELFSDETREADDRALLLKVRDMVRGAADIAKFTQIVEQMRDATERKIEGNPVTAVEVL
FT                   GDKLNVNQEERSGILTHLIQGGDLTAYGMMNAVTRTSQDVESYDRATELEAMGSQVLSL
FT                   PKATWREIAVAR"
FT                   /protein_id="YP_001522313.1"
     GTGTATCTCT TTTCAAGAGG ATACTTCAGC CATTACCAGC GTGACTTCTT GGAATTCGCC        60
     AACAGTGTCA ACCCTTCAAT TACCCCTTTT AAGAAGTATC ACGTTGGCCC ACAGGTTGGT       120
     GAAAGTGATG CAGCCGTAGA ATTGTTCAGC GACGAAACCC GCGAAGCTGA CGATAGAGCG       180
     CTATTGCTCA AAGTTCGAGA CATGGTGCGC GGTGCGGCTG ATATCGCCAA GTTCACCCAA       240
     ATTGTTGAGC AGATGCGAGA TGCCACCGAG CGGAAGATTG AGGGTAACCC GGTCACTGCC       300
     GTGGAGGTAT TAGGCGATAA GCTCAACGTT AATCAGGAAG AGCGCTCTGG AATTCTCACC       360
     CATCTGATCC AGGGTGGCGA CCTGACAGCT TACGGCATGA TGAACGCTGT CACCAGAACA       420
     TCCCAAGATG TTGAGAGCTA CGACCGAGCC ACGGAGTTAG AAGCGATGGG ATCTCAGGTT       480
     CTGAGTCTTC CCAAGGCTAC CTGGCGAGAG ATTGCGGTAG CTCGGTAG                    528
//

If you have problems or comments...

PBIL Back to PBIL home page