(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE8

ACAM1_7.PE8          Location/Qualifiers
FT   CDS_pept        complement(10713..10979)
FT                   /locus_tag="AM1_F0008"
FT                   /gene_family="HOG000219995" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="plasmid stability protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341322"
FT                   /db_xref="GeneID:5686929"
FT                   /translation="MSYSVFLAPAAERQLKKLPNKVKAQIVPILKTLTDDPHPSGSAKL
FT                   KGAEDLWKIRKGAYRVIYQIQDKKLTILVVNIAHRRDVYKDKS"
FT                   /protein_id="YP_001522314.1"
     gtgtcctatt ccgttttcct agcacccgcc gctgagcgac aactcaaaaa gctacccaat        60
     aaagttaagg ctcagattgt tcccatcctt aaaactttga ccgatgatcc acacccatct       120
     ggatcggcaa aattaaaggg ggctgaagat ctttggaaaa tcaggaaggg ggcttatcgc       180
     gtcatttatc agattcaaga caaaaaactc accatactgg ttgtcaatat tgctcacagg       240
     agagatgtct acaaagataa gtcgtag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page